CPT1B Polyclonal Antibody | Invitrogen PA5-79065 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

CPT1B Polyclonal Antibody

catalog :

PA5-79065

quantity :

100 ug

price :

US 410.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

citations: 1

Reference
Patel B, Yao F, Howenstine A, Takenaka R, Hyatt J, Sears K, et al. Emergent Coordination of the CHKB and CPT1B Genes in Eutherian Mammals: Implications for the Origin of Brown Adipose Tissue. J Mol Biol. 2020;432:6127-6145 pubmed publisher

product information

Product Type :

Antibody

Product Name :

CPT1B Polyclonal Antibody

Catalog # :

PA5-79065

Quantity :

100 ug

Price :

US 410.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK).

Format :

Lyophilized

Applications w/Dilutions :

Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

carnitine O-palmitoyltransferase 1, muscle isoform; carnitine O-palmitoyltransferase 1, muscle isoform; synaptonemal complex central element protein 3; carnitine O-palmitoyltransferase 1B; carnitine O-palmitoyltransferase I, mitochondrial muscle isoform; carnitine O-palmitoyltransferase I, muscle isoform; Carnitine palmitoyltransferase 1 beta, muscle isoform; Carnitine palmitoyltransferase 1, muscle; carnitine palmitoyltransferase 1A like; carnitine palmitoyltransferase 1B; carnitine palmitoyltransferase 1B (muscle); carnitine palmitoyltransferase 1B isoform a; carnitine palmitoyltransferase 1b, muscle; carnitine palmitoyltransferase I; carnitine palmitoyltransferase Ibeta 1; carnitine palmitoyltransferase Ibeta 2; carnitine palmitoyltransferase Ibeta 3; carnitine palmitoyltransferase I-like protein; CPT I; Cpt1; cpt1al; CPT1B; CPT1M; Cpt1-m; CPTI; CPTIB; CPT-IB; CPT-Ibeta 1; CPT-Ibeta 3; CPTI-M; EC 2.3.1.21; FLJ55729; FLJ58750; hypothetical protein LOC449677; KIAA1670; LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 1, muscle isoform; MCCPT1; MCPT1; M-CPT1; M-cpti; muscle-type carnitine palmitoyltransferase I; zgc:103709