This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CPT1B Polyclonal Antibody
catalog :
PA5-79065
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
citations: 1
Reference
Patel B, Yao F, Howenstine A, Takenaka R, Hyatt J, Sears K, et al. Emergent Coordination of the CHKB and CPT1B Genes in Eutherian Mammals: Implications for the Origin of Brown Adipose Tissue. J Mol Biol. 2020;432:6127-6145 pubmed publisher
product information
Product Type :
Antibody
Product Name :
CPT1B Polyclonal Antibody
Catalog # :
PA5-79065
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
carnitine O-palmitoyltransferase 1, muscle isoform; carnitine O-palmitoyltransferase 1, muscle isoform; synaptonemal complex central element protein 3; carnitine O-palmitoyltransferase 1B; carnitine O-palmitoyltransferase I, mitochondrial muscle isoform; carnitine O-palmitoyltransferase I, muscle isoform; Carnitine palmitoyltransferase 1 beta, muscle isoform; Carnitine palmitoyltransferase 1, muscle; carnitine palmitoyltransferase 1A like; carnitine palmitoyltransferase 1B; carnitine palmitoyltransferase 1B (muscle); carnitine palmitoyltransferase 1B isoform a; carnitine palmitoyltransferase 1b, muscle; carnitine palmitoyltransferase I; carnitine palmitoyltransferase Ibeta 1; carnitine palmitoyltransferase Ibeta 2; carnitine palmitoyltransferase Ibeta 3; carnitine palmitoyltransferase I-like protein; CPT I; Cpt1; cpt1al; CPT1B; CPT1M; Cpt1-m; CPTI; CPTIB; CPT-IB; CPT-Ibeta 1; CPT-Ibeta 3; CPTI-M; EC 2.3.1.21; FLJ55729; FLJ58750; hypothetical protein LOC449677; KIAA1670; LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 1, muscle isoform; MCCPT1; MCPT1; M-CPT1; M-cpti; muscle-type carnitine palmitoyltransferase I; zgc:103709
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA