This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Carboxypeptidase A1 Polyclonal Antibody
catalog :
PA5-79062
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
Carboxypeptidase A1 Polyclonal Antibody
Catalog # :
PA5-79062
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
CPA1, also known as CPA, is a 419 amino acid secreted monomeric protein that is highly expressed in pancreatic tissue. Functioning as a pancreatic exopeptidase, CPA1 uses zinc as a cofactor to catalyze the release of C-terminal amino acids from a variety of proteins, thereby playing a key role in protein digestion and degradation. Via its catalytic activity, CPA1 is also thought to be involved in zymogen (proenzyme) inhibition, probably functioning to block enzyme activation pathways. Abnormal levels of CPA1 are associated with pancreatic cancer, suggesting a possible role in either tumor progression or tumor suppression events.
Immunogen :
(KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAA
FTAILDTLD).
A synthetic peptide corresponding to a sequence of human Carboxypeptidase A
FTAILDTLD).
A synthetic peptide corresponding to a sequence of human Carboxypeptidase A
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
0910001L12Rik; carboxypeptidase A; carboxypeptidase A1; carboxypeptidase A1 (pancreatic); carboxypeptidase A1, pancreatic; CPA; Cpa1; pancreatic carboxypeptidase A; pancreatic procarboxypeptidase A
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments