This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CHK2 Polyclonal Antibody
catalog :
PA5-79041
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CHK2 Polyclonal Antibody
Catalog # :
PA5-79041
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
CHEK2 (CHK2) is a serine/threonine kinase and a component of the DNA damage checkpoint pathway. A mutation in CHK2 has been linked to cancer. CHK2 is activated by DNA damage and phosphorylates several modulators of cell cycle control including tumor suppressor proteins. In addition, Chk2 can phosphorylate BRCA1, allowing BRCA1 to restore survival after DNA damage. Chk2 is a putative tumor suppressor protein, with mutations in to the Chk2 gene linked to Li-Fraumeni syndrome, a familiar cancer usually associated with inherited mutations in TP53. Also, mutations in CHK2 are thought to confer a predisposition to sarcomas, breast cancer, and brain tumors.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
CDS1; cds1 homolog; Checkpoint kinase 2; Checkpoint like protein CHK2; checkpoint-like protein CHK2; Chek2; Chk2; Chk2 (phospho T68); Chk2 (pThr68); CHK2 checkpoint homolog; CHK2 checkpoint homolog (S. pombe); Chk2 phospho; Chk2 phospho T68; del9; EC 2.7.11.1; hCds1; HuCds 1; HuCds1; kinase Chk2; LFS2; OTTHUMP00000199044; OTTHUMP00000199045; OTTHUMP00000199064; OTTHUMP00000199115; OTTHUMP00000199116; phospho Chk2 (T68); phospho Thr68 Chk2; PP1425; protein kinase Chk2; Rad53; Rad53 homolog; RP11-436C9.1; Serine/threonine protein kinase Chk2; serine/threonine-protein kinase Chk2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments