This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CDC20 Polyclonal Antibody
catalog :
PA5-79013
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
Product Type :
Antibody
Product Name :
CDC20 Polyclonal Antibody
Catalog # :
PA5-79013
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.
Immunogen :
(QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPE
GYQNRLKVLYSQKAT).
A synthetic peptide corresponding to a sequence of human Cdc20
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
2310042N09Rik; bA276H19.3; C87100; cdc20; CDC20 cell division cycle 20 homolog; cdc20.S; CDC20A; cell cycle protein p55CDC; cell division cycle 20; cell division cycle 20 homolog; cell division cycle 20 S homeolog; cell division cycle protein 20 homolog; fizzy1; mmCdc20; p55cdc; XELAEV_18025163mg; X-FZY
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA