This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CD5 Polyclonal Antibody
catalog :
PA5-78989
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, flow cytometry
product information
Product Type :
Antibody
Product Name :
CD5 Polyclonal Antibody
Catalog # :
PA5-78989
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
CD5 is a 67 kDa human T-lymphocyte single-chain transmembrane glycoprotein. CD5 is present on all mature T-lymphocytes, on most of thymocytes and on many T-cell leukemias and lymphomas. CD5 also reacts with a subpopulation of activated B-cells and may act as a receptor in regulating T-cell proliferation. CD5 is found on 95% of thymocytes and 72% of peripheral blood lymphocytes. In lymph nodes, the main reactivity is observed in T cell areas. CD5 is expressed by many T cell leukemia, lymphomas, and activated T cells. Diseases associated with CD5 dysfunction include thymus cancer and Richter's Syndrome.
Immunogen :
A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL
Aliases :
alanyl (membrane) aminopeptidase; alanyl aminopeptidase; alanyl aminopeptidase, membrane; aminopeptidase M; Aminopeptidase N; ANPEP; AP-M; APN; AP-N; CD antigen CD5; CD13; CD28; CD28 antigen (Tp44); CD28 molecule; Cd5; CD5 antigen; CD5 antigen (p56 62); CD5 antigen (p56-62); CD5 antigen p56-62; CD5 molecule; CD5 protein; CD74 antigen, invariant polypeptide of major; cell surface protein; costimulatory molecule B7 receptor CD28; fCD5; GP150; hAPN; LAP1; LEU1; Ly-1; Ly12; Ly-12; LyA; Ly-A; Lymphocyte antigen 1; Lymphocyte antigen CD5; lymphocyte antigen T1/Leu-1; Lyt-1; membrane alanyl aminopeptidase; microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; P150; Pan T cell; PEPN; T1; T-cell costimulatory molecule CD28; T-cell surface glycoprotein CD5; T-cell-specific surface glycoprotein CD28; unnamed protein product
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments