This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CD47 Polyclonal Antibody
catalog :
PA5-78986
quantity :
100 ug
price :
US 400.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
Product Type :
Antibody
Product Name :
CD47 Polyclonal Antibody
Catalog # :
PA5-78986
Quantity :
100 ug
Price :
US 400.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
CD47 (integrin-associated protein, IAP) is a ubiquitously expressed cell surface transmembrane glycoprotein interacting with several integrins and regulating their functions. Engagement of CD47 by soluble ligands or counter receptors modulates various signaling pathways, such as activation of heterotrimeric G proteins. Functionally, CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. CD47 is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. CD47 has broad tissue distribution, is reduced in expression on Rh erythrocytes. CD47 acts as a ligand for CD172a (signal regulatory protein alpha, SIRP alpha), an immune inhibitory receptor on macrophages; this interaction prevents phagocytosis of CD47-positive cells. Moreover, CD47-CD172a system affects cell migration, B cell adhesion, T cell activation, and is involved in modulation of chondrocyte responses to mechanical signals, and promotes neuronal development, being especially abundant in synapse-rich regions of brain and retina.
Immunogen :
A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
9130415E20Rik; AA407862; AI848868; antigen identified by monoclonal antibody 1D8; antigenic surface determinant protein OA3; AW108519; B430305P08Rik; Cd47; CD47 antigen; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 antigen/integrin-associated protein; CD47 glycoprotein; CD47 molecule; CD47/IAP; IAP; integrin associated protein; integrin-associated protein; integrin-associated signal transducer; Itgp; Leukocyte surface antigen CD47; MER6; OA3; Protein MER6; Rh-related antigen; sCD47; soluble CD 47; soluble CD47
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA