This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
DC-SIGN (CD209) Polyclonal Antibody
catalog :
PA5-78968
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section
citations: 1
Reference
Gregory K, Morin S, Kubosiak A, Ser Dolansky J, Schalet B, Jerry D, et al. The use of patient-derived breast tissue explants to study macrophage polarization and the effects of environmental chemical exposure. Immunol Cell Biol. 2020;98:883-896 pubmed publisher
product information
Product Type :
Antibody
Product Name :
DC-SIGN (CD209) Polyclonal Antibody
Catalog # :
PA5-78968
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
Immunogen :
A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
CD209; CD209 antigen; CD209 antigen-like protein A; CD209 molecule; Cd209a; CD209a antigen; CD209a molecule; Cd209d; CD209d antigen; CDSIGN; Cire; CLEC4L; Clec4m; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; C-type lectin domain family 4, member M; Dcsign; DC-SIGN; DC-SIGN1; Dc-signr; DC-SIGN-related protein; Dendritic cell-specific ICAM-3-grabbing non-integrin; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; HIV gpl20-binding protein; MGC129965; MGC130443; RGD1561104; SIGN-R1; SIGNR5
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA