CCT3 Polyclonal Antibody | Invitrogen PA5-78953 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

CCT3 Polyclonal Antibody

catalog :

PA5-78953

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

citations: 1

Reference
Tudor M, Gilbert A, Lepleux C, Temelie M, Hem S, Armengaud J, et al. A Proteomic Study Suggests Stress Granules as New Potential Actors in Radiation-Induced Bystander Effects. Int J Mol Sci. 2021;22: pubmed publisher

product information

Product Type :

Antibody

Product Name :

CCT3 Polyclonal Antibody

Catalog # :

PA5-78953

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Immunogen :

EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSR
Q).
A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

AL024092; CCT3; CCTG; CCT-gamma; chaperonin containing TCP1 subunit 3; chaperonin containing Tcp1, subunit 3 (gamma); chaperonin subunit 3 (gamma); hTRiC5; Matricin; mTRiC-P5; OTTHUMP00000025735; PIG48; T-complex protein 1 subunit gamma; T-complex protein 1, gamma subunit; TCP1 (t-complex-1) ring complex, polypeptide 5; TCP-1-gamma; Tcp1-rs3; TRIC5; TriC-P5