BMP5 Polyclonal Antibody, DyLight 488 | Invitrogen PA5-78877 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

BMP5 Polyclonal Antibody, DyLight 488

catalog :

PA5-78877

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

DyLight488

reactivity :

human

application :

flow cytometry

product information

Product Type :

Antibody

Product Name :

BMP5 Polyclonal Antibody, DyLight 488

Catalog # :

PA5-78877

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells

Species :

Human

Isotype :

IgG

Storage :

4 C, store in dark, DO NOT FREEZE!

Description :

TGF-ß family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling, and maintenance of a variety of other tissues and organs. BMP-5 is expressed in the nervous system, lungs and liver. It is a known regulator for dendritic growth in sympathetic neurons. BMP-5 is a 454 amino acid precursor protein that is cleaved to release the biologically active C-terminal mature protein.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).

Format :

Liquid

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells

Aliases :

AU023399; BMP; BMP 5; Bmp5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; bone morphogenetic protein 5; MGC34244; se; short ear