This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
BMP4 Polyclonal Antibody
catalog :
PA5-78876
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, ELISA
product information
Product Type :
Antibody
Product Name :
BMP4 Polyclonal Antibody
Catalog # :
PA5-78876
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse
Applications :
ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse
Isotype :
IgG
Storage :
-20 C
Description :
The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND).
Format :
Lyophilized
Applications w/Dilutions :
ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
BMP; BMP2B; BMP-2B; Bmp2b1; Bmp2b-1; Bmp4; Bmp-4; BOMPR4A; Bone morphogenetic protein; Bone morphogenetic protein 2B; bone morphogenetic protein 4; bone morphogenetic protein 4 preproprotein; DVR4; Dvr-4; MCOPS6; OFC11; ZYME
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
