This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
BCAR3 Polyclonal Antibody
catalog :
PA5-78858
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
BCAR3 Polyclonal Antibody
Catalog # :
PA5-78858
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AI131758; And34; AND-34; Bcar3; breast cancer anti-estrogen resistance 3; breast cancer antiestrogen resistance 3 protein; breast cancer anti-estrogen resistance protein 3; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); KIAA0554; novel SH2-containing protein 2; NSP2; OTTHUMP00000011961; p130Cas-binding protein AND-34; SH2 domain-containing protein 3B; SH2D3B; UNQ271/PRO308
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA