This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Bax Polyclonal Antibody
catalog :
PA5-78857
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section
citations: 1
Reference
Nabil M, Kassem D, Ali A, El Mesallamy H. Adipose tissue-derived mesenchymal stem cells ameliorate cognitive impairment in Alzheimer's disease rat model: Emerging role of SIRT1. Biofactors. 2023;49:1121-1142 pubmed publisher
product information
Product Type :
Antibody
Product Name :
Bax Polyclonal Antibody
Catalog # :
PA5-78857
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
BAX is a members of the Bcl-2 Family and plays an important role in regulation of apoptosis. Whereas Bcl-2 is commonly regarded as an anti-apoptotic protein, BAX is considered to have a pro-apoptotic function. Regulation of apoptosis is supposed to involve both homo- and heterodimerization of different isoforms of BAX and Bcl-2. The Bax gene encodes different isoforms including Bax alpha (21 kDa) and Bax beta (24 kDa), whereas both isoforms contain the BH1, BH2 and BH3 domains, Bax beta has a unique carboxyl terminus and does not contain a hydrophobic transmembrane domain. Bcl-2 is also expressed in different Isoforms. Bcl-2 beta differs in the 3' UTR and coding region compared to variant alpha. Bcl-2 beta is shorter (22 kDa) and has a distinct C-terminus compared to Bcl-2 alpha (26 kDa). BAX is a member of the BCL-2 family of proteins, which function as regulators of apoptosis. Overexpression of BAX functions to promote cell death. BAX can form homodimers and is also able to heterodimerize with other BCL-2 related proteins.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
apoptosis regulator BAX; Apoptosis regulator Bcl-X; Bax; Bax zeta; BAX-ALPHA; Bax-alpha protein; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; BCL2 associated X protein; BCL2 associated X, apoptosis regulator; BCL2 like 1; BCL2-associated protein; Bcl-2-associated protein Bax; Bcl2-associated protein Bax; Bcl-2-associated X protein; BCL2-associated X protein; BCL2-associated X protein omega; BCL2L; BCL2L1; Bcl2-L-1; BCL2L4; Bcl2-L-4; BCL2-like 1; bcl-2-like protein 1; Bcl-2-like protein 4; BCLX; Bcl-X; BCL-XL/S; PPP1R52; protein phosphatase 1, regulatory subunit 52
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA