This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ASPH Polyclonal Antibody
catalog :
PA5-78827
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
citations: 1
Reference
Babich M, Sharma A, Li T, Radosevich J. Labyrinthin: A distinct pan-adenocarcinoma diagnostic and immunotherapeutic tumor specific antigen. Heliyon. 2022;8:e08988 pubmed publisher
product information
Product Type :
Antibody
Product Name :
ASPH Polyclonal Antibody
Catalog # :
PA5-78827
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Immunohistochemistry: 1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Immunohistochemistry: 1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
2310005F16Rik; 3110001L23Rik; A beta H-J-J; AAH; AI848629; ASP beta-hydroxylase; Aspartate beta-hydroxylase; aspartate-beta-hydroxylase; aspartyl (asparaginyl) beta hydroxylase; aspartyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase-like; aspartyl/asparaginyl-beta-hydroxylase; ASPH; AW261690; AW561901; BAH; C79816; calsequestrin-binding protein; cardiac junctin; CASQ2BP1; cI-37; FDLAB; HAAH; humbug; JCTN; jumbug; junctate; junctin; junctional sarcoplasmic reticulum protein; peptide-aspartate beta-dioxygenase; Unknown (protein for MGC:137539)
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA