This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ASL Polyclonal Antibody
catalog :
PA5-78826
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
ASL Polyclonal Antibody
Catalog # :
PA5-78826
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
ASL encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.
Immunogen :
A synthetic peptide corresponding to a sequence of human Argininosuccinate Lyase/ASL (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
2510006M18Rik; argininosuccinase; argininosuccinate lyase; Arginosuccinase; ASAL; Asl
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments