This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ALOX12 Polyclonal Antibody
catalog :
PA5-78760
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
citations: 1
Reference
Elchaninov A, Lokhonina A, Nikitina M, Vishnyakova P, Makarov A, Arutyunyan I, et al. Comparative Analysis of the Transcriptome, Proteome, and miRNA Profile of Kupffer Cells and Monocytes. Biomedicines. 2020;8: pubmed publisher
product information
Product Type :
Antibody
Product Name :
ALOX12 Polyclonal Antibody
Catalog # :
PA5-78760
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The ALOX12 gene encodes the enzyme arachidonate 12-lipoxygenase, a member of the lipoxygenase family that metabolizes arachidonic acid into bioactive lipid mediators. ALOX12 catalyzes the formation of 12-hydroperoxyeicosatetraenoic acid (12-HPETE), which is further reduced to 12-hydroxyeicosatetraenoic acid (12-HETE). These products are involved in various biological processes, including inflammation, cellular signaling, and blood platelet function. ALOX12 plays a significant role in pathophysiological conditions such as cancer, cardiovascular diseases, and inflammatory disorders. Dysregulation or altered expression of ALOX12 has been implicated in tumorigenesis and metastasis, where its metabolites influence cell proliferation, migration, and survival. Additionally, ALOX12 impacts platelet aggregation and inflammation, making it a potential target for therapeutic strategies aimed at treating diseases linked to lipid mediator imbalances. Research into ALOX12 continues to explore its functions in health and disease, emphasizing its importance in lipid metabolism and signaling pathways.
Immunogen :
ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQD
DELFSYQ).
A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
12(S)-lipoxygenase; 12LO; 12-LO; 12LOX; 12-LOX; 12S LOX; 12S-lipoxygenase; 12S-LOX; 9930022G08Rik; ALOX12; Alox12p; arachidonate 12-lipoxygenase; arachidonate 12-lipoxygenase, 12S type; arachidonate 12-lipoxygenase, 12S-type; Arachidonate 15-lipoxygenase,15S-type; Linoleate 13S-lipoxygenase; Lipoxin synthase 12-LO; LOG12; P-12LO; platelet 12-LOX; platelet-type 12-lipoxygenase; platelet-type lipoxygenase 12
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA