ALDH7A1 Polyclonal Antibody | Invitrogen PA5-78759 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

ALDH7A1 Polyclonal Antibody

catalog :

PA5-78759

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

product information

Product Type :

Antibody

Product Name :

ALDH7A1 Polyclonal Antibody

Catalog # :

PA5-78759

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

26g turgor protein homolog; Ald7a1; aldehyde dehydrogenase 7 family member A1; aldehyde dehydrogenase 7 family, member A1; aldehyde dehydrogenase family 7 member A1; aldehyde dehydrogenase family 7, member A1; Aldh7a1; Alpha-AASA dehydrogenase; alpha-aminoadipic semialdehyde dehydrogenase; antiquitin; Antiquitin 1; Antiquitin1; Antiquitin-1; ATQ1; Betaine aldehyde dehydrogenase; D18Wsu181e; delta1-piperideine-6-carboxylate dehydrogenase; delta1-piperideine-6-carboxylate dehydrogenease; EPD; P6c dehydrogenase; PDE