This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ACSL5 Polyclonal Antibody
catalog :
PA5-78714
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, flow cytometry
product information
Product Type :
Antibody
Product Name :
ACSL5 Polyclonal Antibody
Catalog # :
PA5-78714
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.
Immunogen :
ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLL
KLA).
A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa
KLA).
A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL
Aliases :
1700030F05Rik; ACS2; ACS5; Acsl5; acyl-CoA synthetase 5; acyl-CoA synthetase long chain family member 5; acyl-CoA synthetase long-chain family member 5; Arachidonate--CoA ligase; FACL5; FACL5 for fatty acid coenzyme A ligase 5; fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase, long chain 5; fatty-acid-Coenzyme A ligase, long-chain 5; HGNC:16526; LACS 5; Long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; long-chain-fatty-acid--CoA ligase 5; UNQ633/PRO1250; zgc:92083
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
