This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ABCG8 Polyclonal Antibody
catalog :
PA5-78703
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry
product information
Product Type :
Antibody
Product Name :
ABCG8 Polyclonal Antibody
Catalog # :
PA5-78703
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
ATP-binding cassette (ABC) transporter genes are involved in the regulation of the amount of dietary cholesterol retained in the body. ABCG8, expressed at high levels in the liver and intestine, normally cooperates with ABCG5 to limit intestinal absorption and promote biliary excretion of sterols. The mutated form of this transporter can lead to sterol accumulation and atherosclerosis or sitosterolemia, a rare autosomal recessive disorder, characterized by hyperabsorption of sterols and the inability to excrete sterols into bile.
Immunogen :
DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETK
DLDED).
A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa
DLDED).
A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa
Format :
Lyophilized
Applications w/Dilutions :
Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
1300003C16Rik; ABCG8; AI114946; ATP binding cassette subfamily G member 8; ATP-binding cassette sub-family G member 8; ATP-binding cassette, subfamily G (WHITE), member 8; ATP-binding cassette, sub-family G (WHITE), member 8; ATP-binding cassette, subfamily G, member 8; GBD4; MGC142217; sterolin 2; Sterolin2; sterolin-2; STSL
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments