This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
HO-1 Polyclonal Antibody
catalog :
PA5-77833
quantity :
100 ug
price :
US 504.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs
application :
western blot, immunohistochemistry, immunocytochemistry
citations: 9
Reference |
---|
product information
Product Type :
Antibody
Product Name :
HO-1 Polyclonal Antibody
Catalog # :
PA5-77833
Quantity :
100 ug
Price :
US 504.00
Clonality :
Polyclonal
Purity :
protein A
Host :
Rabbit
Reactivity :
Canine, Human, Mouse, Rat
Applications :
Immunocytochemistry: 1:100, Immunohistochemistry (PFA fixed): 1:100, Western Blot: 1:1,000
Species :
Canine, Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO-1 and a constitutively expressed HO-2. HO-1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO-1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.
Immunogen :
Human heme-oxygenase (HO-1) synthetic multiple antigenic peptide (aa. 1-30)1 : MERPQPDSMPQDLSEALKEATKEVHTQAEN
Format :
Liquid
Applications w/Dilutions :
Immunocytochemistry: 1:100, Immunohistochemistry (PFA fixed): 1:100, Western Blot: 1:1,000
Aliases :
bK286B10; D8Wsu38e; heat shock protein 32; heat shock protein, 32-kD; heme orygenase 1; heme oxygenase; heme oxygenase (decycling) 1; heme oxygenase (decyclizing) 1; heme oxygenase 1; heme oxygenase-1; Hemox; hemoxygenase; Heox; HEOXG; Hmox; Hmox1; HMOX1D; HO; Ho1; HO-1; Hsp32; P32 protein
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments