HO-1 Polyclonal Antibody | Invitrogen PA5-77833 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

HO-1 Polyclonal Antibody

catalog :

PA5-77833

quantity :

100 ug

price :

US 504.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs

application :

western blot, immunohistochemistry, immunocytochemistry

citations: 9

Reference
Rajendran P, Al Saeedi F, Ammar R, Abdallah B, Ali E, Al Abdulsalam N, et al. Geraniol attenuates oxidative stress and neuroinflammation-mediated cognitive impairment in D galactose-induced mouse aging model. Aging (Albany NY). 2024;16:5000-5026 pubmed publisher
Yang A, Kim K, Kwon H, Leem J, Song J. 6-Shogaol Ameliorates Liver Inflammation and Fibrosis in Mice on a Methionine- and Choline-Deficient Diet by Inhibiting Oxidative Stress, Cell Death, and Endoplasmic Reticulum Stress. Molecules. 2024;29: pubmed publisher
Ben Ammar R, Zahra H, Abu Zahra A, Alfwuaires M, Abdulaziz Alamer S, Metwally A, et al. Protective Effect of Fucoxanthin on Zearalenone-Induced Hepatic Damage through Nrf2 Mediated by PI3K/AKT Signaling. Mar Drugs. 2023;21: pubmed publisher
Wu S, Xia Y, Yang C, Li M. Protective effects of aloin on asthmatic mice by activating Nrf2/HO-1 pathway and inhibiting TGF-β/Smad2/3 pathway. Allergol Immunopathol (Madr). 2023;51:10-18 pubmed publisher
Yang B, Yang S, Kim S, Baek A, Sung B, Kim Y, et al. Flavonoid-Conjugated Gadolinium Complexes as Anti-Inflammatory Theranostic Agents. Antioxidants (Basel). 2022;11: pubmed publisher
Elsawy H, Rajendran P, Sedky A, Alfwuaires M. Ruscogenin Protects Against Deoxynivalenol-Induced Hepatic Injury by Inhibiting Oxidative Stress, Inflammation, and Apoptosis Through the Nrf2 Signaling Pathway: An In vitro Study. Saudi J Med Med Sci. 2022;10:207-215 pubmed publisher
Su Y, Xu J, Chen S, Feng J, Li J, Lei Z, et al. Astragaloside IV protects against ischemia/reperfusion (I/R)-induced kidney injury based on the Keap1-Nrf2/ARE signaling pathway. Transl Androl Urol. 2022;11:1177-1188 pubmed publisher
Alzahrani A, Rajendran P, Veeraraghavan V, Hanieh H. Cardiac Protective Effect of Kirenol against Doxorubicin-Induced Cardiac Hypertrophy in H9c2 Cells through Nrf2 Signaling via PI3K/AKT Pathways. Int J Mol Sci. 2021;22: pubmed publisher
Rajendran P, Ammar R, Al Saeedi F, Mohamed M, ElNaggar M, Al ramadan S, et al. Kaempferol Inhibits Zearalenone-Induced Oxidative Stress and Apoptosis via the PI3K/Akt-Mediated Nrf2 Signaling Pathway: In Vitro and In Vivo Studies. Int J Mol Sci. 2020;22: pubmed publisher

product information

Product Type :

Antibody

Product Name :

HO-1 Polyclonal Antibody

Catalog # :

PA5-77833

Quantity :

100 ug

Price :

US 504.00

Clonality :

Polyclonal

Purity :

protein A

Host :

Rabbit

Reactivity :

Canine, Human, Mouse, Rat

Applications :

Immunocytochemistry: 1:100, Immunohistochemistry (PFA fixed): 1:100, Western Blot: 1:1,000

Species :

Canine, Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO-1 and a constitutively expressed HO-2. HO-1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO-1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.

Immunogen :

Human heme-oxygenase (HO-1) synthetic multiple antigenic peptide (aa. 1-30)1 : MERPQPDSMPQDLSEALKEATKEVHTQAEN

Format :

Liquid

Applications w/Dilutions :

Immunocytochemistry: 1:100, Immunohistochemistry (PFA fixed): 1:100, Western Blot: 1:1,000

Aliases :

bK286B10; D8Wsu38e; heat shock protein 32; heat shock protein, 32-kD; heme orygenase 1; heme oxygenase; heme oxygenase (decycling) 1; heme oxygenase (decyclizing) 1; heme oxygenase 1; heme oxygenase-1; Hemox; hemoxygenase; Heox; HEOXG; Hmox; Hmox1; HMOX1D; HO; Ho1; HO-1; Hsp32; P32 protein