This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CRB1 Polyclonal Antibody
catalog :
PA5-143856
quantity :
100 ug
price :
US 394.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CRB1 Polyclonal Antibody
Catalog # :
PA5-143856
Quantity :
100 ug
Price :
US 394.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
CRB1 (Crumbs homolog 1) plays a role in photoreceptor morphogenesis in the retina. It may maintain cell polarization and adhesion. CRB1 is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. The first identified human homolog, CRB1, is expressed in retina and some parts of the brain, leaving room for another homolog to function in epithelial tissues. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis.
Immunogen :
A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
CRB1; crumbs 1, cell polarity complex component; crumbs family member 1, photoreceptor morphogenesis associated; Crumbs homolog 1; LCA8; Protein crumbs homolog 1; RP12
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA