This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
LRTOMT Polyclonal Antibody
catalog :
PA5-114402
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
LRTOMT Polyclonal Antibody
Catalog # :
PA5-114402
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 1-2 ug/mL, Western Blot: 0.5-1 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Required for auditory function.
Immunogen :
A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 1-2 ug/mL, Western Blot: 0.5-1 ug/mL
Aliases :
1700008D07Rik; Catechol O-methyltransferase 2; catechol O-methyltransferase 2 {ECO:0000250; CFAP111; Comt2; DFNB63; leucine rich repeat containing 51; leucine rich transmembrane and 0-methyltransferase domain containing; leucine rich transmembrane and O-methyltransferase domain containing; leucine-rich repeat-containing protein 51; leucine-rich repeat-containing protein 51 {ECO:0000312; leucine-rich repeat-containing protein 51; transmembrane O-methyltransferase; LRRC51; lrrc51 {ECO:0000312; Lrtomt; Lrtomt1; O-methyltransferase domain containing; PP7517; Protein LRTOMT1; protein LRTOMT2; RGD:1561509}; RGD:1565856}; RGD1561509; RGD1565856; Tomt; tomt {ECO:0000312; Transmembrane O-methyltransferase; transmembrane O-methyltransferase {ECO:0000312; Transmembrane O-methyltransferase homolog; UniProtKB:A1Y9I9}
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments