LRTOMT Polyclonal Antibody | Invitrogen PA5-114402 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

LRTOMT Polyclonal Antibody

catalog :

PA5-114402

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

LRTOMT Polyclonal Antibody

Catalog # :

PA5-114402

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunohistochemistry (Paraffin): 1-2 ug/mL, Western Blot: 0.5-1 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Required for auditory function.

Immunogen :

A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL).

Format :

Lyophilized

Applications w/Dilutions :

Immunohistochemistry (Paraffin): 1-2 ug/mL, Western Blot: 0.5-1 ug/mL

Aliases :

1700008D07Rik; Catechol O-methyltransferase 2; catechol O-methyltransferase 2 {ECO:0000250; CFAP111; Comt2; DFNB63; leucine rich repeat containing 51; leucine rich transmembrane and 0-methyltransferase domain containing; leucine rich transmembrane and O-methyltransferase domain containing; leucine-rich repeat-containing protein 51; leucine-rich repeat-containing protein 51 {ECO:0000312; leucine-rich repeat-containing protein 51; transmembrane O-methyltransferase; LRRC51; lrrc51 {ECO:0000312; Lrtomt; Lrtomt1; O-methyltransferase domain containing; PP7517; Protein LRTOMT1; protein LRTOMT2; RGD:1561509}; RGD:1565856}; RGD1561509; RGD1565856; Tomt; tomt {ECO:0000312; Transmembrane O-methyltransferase; transmembrane O-methyltransferase {ECO:0000312; Transmembrane O-methyltransferase homolog; UniProtKB:A1Y9I9}