This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CXCL12 Polyclonal Antibody
catalog :
PA1-29029
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
mouse, rat
application :
western blot, immunohistochemistry, immunoprecipitation
citations: 2
Reference
He X, Li C, Yin H, Tan X, Yi J, Tian S, et al. Mesenchymal stem cells inhibited the apoptosis of alveolar epithelial cells caused by ARDS through CXCL12/CXCR4 axis. Bioengineered. 2022;13:9060-9070 pubmed publisher
Geng X, Hu Z, Lian G. Erythropoietin ameliorates renal interstitial fibrosis via the inhibition of fibrocyte accumulation. Mol Med Rep. 2015;11:3860-5 pubmed publisher
product information
Product Type :
Antibody
Product Name :
CXCL12 Polyclonal Antibody
Catalog # :
PA1-29029
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
protein A
Host :
Rabbit
Reactivity :
Mouse, Rat
Applications :
Immunohistochemistry: 1:100-1:500, Immunoprecipitation: 1:300-1:500, Western Blot: 1:1,000
Species :
Mouse, Rat
Isotype :
IgG
Storage :
Store at 4 C short term. For long term storage, store at -20 C, avoiding freeze/thaw cycles.
Description :
CXCL12 is a stromal cell-derived alpha chemokine member of the intercrine family. This gene product and its receptor CXCR4 can activate lymphocytes and have been implicated in the metastasis of some cancers such as breast cancer. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen :
(aa 20-89).
DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQ
IVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Recombinant protein was generated using E coli-expressed mouse SDF-1alpha as an immunogen. The sequence of mouse SDF-1 alpha antigen is
Format :
Liquid
Applications w/Dilutions :
Immunohistochemistry: 1:100-1:500, Immunoprecipitation: 1:300-1:500, Western Blot: 1:1,000
Aliases :
12-O-tetradecanoylphorbol 13-acetate repressed protein 1; AI174028; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; chemokine (C-X-C motif) ligand 12; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); CXC; CXC motif chemokine; C-X-C motif chemokine 12; C-X-C motif chemokine ligand 12; CXCL; Cxcl12; hIRH; hSDF-1; Intercrine reduced in hepatomas; IRH; PBSF; pre-B cell growth-stimulating factor; pre-B-cell growth-stimulating factor; Scyb12; Sdf1; SDF-1; SDF-1 gamma; SDF1A; SDF-1a; SDF-1-alpha(3-67); SDF1B; SDF-1b; SDF-1-beta(3-72); Stromal cell-derived factor 1; stromal cell-derived factor-1 alpha; stromal cell-derived factor-1 gamma; thymic lymphoma cell-stimulating factor; TLSF; Tlsfa; TLSF-a; Tlsfb; TLSF-b; Tpar1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA