This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CCL4 Polyclonal Antibody
catalog :
PA1-28319
quantity :
50 µg
price :
399 USD
clonality :
polyclonal
host :
chicken
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA
product information
Product Type :
Antibody
Product Name :
CCL4 Polyclonal Antibody
Catalog # :
PA1-28319
Quantity :
50 µg
Price :
399 USD
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Chicken
Reactivity :
Human
Applications :
ELISA: Assay-dependent, Western Blot: 1:500
Species :
Human
Isotype :
IgY
Storage :
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Description :
CCL4 (macrophage inflammatory protein 1-beta, MIP1B) belongs to the intercrine beta (chemokine CC) family. Functionally, CCL4 is involved in chemotactic and proinflammatory effects, and homeostasis. CCL4 is produced by macrophages upon stimulation by bacterial endotoxins. CCL4 recruits and stimulates various inflammatory cells at sites of inflammation. CCL4 is produced by lymphocytes, macrophages and dendritic cells. Both CCL4 and the related protein CCL3 participate in the host response to invading bacterial, viral, parasite and fungal pathogens by regulating the trafficking and activation state of selected subgroups of inflammatory cells. While both CCL4 and CCL3 exert similar effects on monocytes, their effect on lymphocytes differ, with CCL4 selectively attracting CD4+ lymphocytes and CCL3 selectively attracting CD8+ lymphocytes. Additionally, both have been shown to be potent chemoattractants for B cells, eosinophils and dendritic cells. The processed form of CCL4 can induce down-modulation of surface expression of the chemokine receptor CCR5, thus inhibiting the CCR5-mediated entry of HIV-1 in T cells. CCL4 binds with high affinity to CCR5 receptors.
Immunogen :
corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta.
GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVF
QTKRSKQVCADPSESWVQEYVYDLELN,
synthetic peptide
Format :
Liquid
Applications w/Dilutions :
ELISA: Assay-dependent, Western Blot: 1:500
Aliases :
ACT2; ACT-2; AT744.1; CC chemokine ligand 4; C-C motif chemokine 4; C-C motif chemokine ligand 4; CCL4; chemokine (C-C motif) ligand 4; G-26; G-26 T-lymphocyte-secreted protein; HC21; immune activation gene 2; immune activation protein 2; LAG1; LAG-1; Lymphocyte activation gene 1 protein; Macrophage inflammatory protein 1-beta; macrophage inflammatory protein-1 beta; MGC104418; MGC126025; MGC126026; MIP-1 beta; Mip1b; MIP-1B; Mip1-b; MIP1B1; MIP1beta; MIP-1BETA; MIP-1-beta; MIP1-beta; MIP-1-beta(1-69); MIP-1-beta(3-69); PAT 744; Protein H400; putative MIP-1beta protein; RP23-320E6.8; SCY4A; SCYA2; SCYA4; secreted protein G-26; SIS-gamma; small inducible cytokine A4; small inducible cytokine A4 (homologous to mouse Mip-1b); small-inducible cytokine A4; T-cell activation protein 2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA