UHRF2 Monoclonal Antibody (6B5) | Invitrogen MA5-49293 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

UHRF2 Monoclonal Antibody (6B5)

catalog :

MA5-49293

quantity :

100 ug

price :

US 404.00

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6B5

reactivity :

human, rat

application :

western blot, immunocytochemistry, flow cytometry

product information

Product Type :

Antibody

Product Name :

UHRF2 Monoclonal Antibody (6B5)

Catalog # :

MA5-49293

Quantity :

100 ug

Price :

US 404.00

Clonality :

Monoclonal

Purity :

Antigen affinity chromatography

Host :

Mouse

Reactivity :

Human, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Western Blot: 0.25-0.5 ug/mL

Species :

Human, Rat

Clone :

6B5

Isotype :

IgG2b

Storage :

-20 C

Description :

This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Immunogen :

TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLE
N).
A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Western Blot: 0.25-0.5 ug/mL

Aliases :

2310065A22Rik; AI426270; AW214556; D130071B19Rik; E3 ubiquitin-protein ligase UHRF2; Nirf; np95/ICBP90-like RING finger protein; Np95-like ring finger protein; Nuclear protein 97; nuclear zinc finger protein Np97; RING finger protein 107; RING-type E3 ubiquitin transferase UHRF2; RNF107; RP11-472F14.2; TDRD23; ubiquitin like with PHD and ring finger domains 2; ubiquitin-like PHD and RING finger domain-containing protein 2; ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase; ubiquitin-like, containing PHD and RING finger domains 2; ubiquitin-like, containing PHD and RING finger domains, 2; ubiquitin-like-containing PHD and RING finger domains protein 2; UHRF2; URF2