MSI1 Monoclonal Antibody (2B9) | Invitrogen MA5-49284 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

MSI1 Monoclonal Antibody (2B9)

catalog :

MA5-49284

quantity :

100 ug

price :

US 404.00

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2B9

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

MSI1 Monoclonal Antibody (2B9)

Catalog # :

MA5-49284

Quantity :

100 ug

Price :

US 404.00

Clonality :

Monoclonal

Purity :

Antigen affinity chromatography

Host :

Mouse

Reactivity :

Human, Mouse, Rat

Applications :

Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Clone :

2B9

Isotype :

IgG2b

Storage :

-20 C

Description :

Musashi-1 belongs to the Musashi family of RNA-binding proteins which play a role in cell fate determination, and maintenance of stem-cell state. Musashi family proteins are also involved in post transcriptional gene regulation. The gene encodes a protein with two conserved tandem RNA recognition motifs with highly conserved RNP (ribonucleoprotein) motifs. In mammals, Musashi-1 is expressed in fetal kidney, brain, liver and lung, and in adult brain and pancreas. In humans, the gene is located on chromosome 12.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD).

Format :

Lyophilized

Applications w/Dilutions :

Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

fb40b12; hypothetical protein LOC541389; m-Msi-1; ms1; msi1; msi1b; Msi1h; Musahi1; musashi homolog 1; Musashi homolog 1(Drosophila); musashi RNA binding protein 1; musashi RNA binding protein 1b; musashi RNA-binding protein 1; musashi1; musashi-1; RNA-binding protein Musashi homolog 1; RNA-binding protein Musashi homolog 1 L+35bp; RNA-binding protein Musashi homolog 1 Long; RNA-binding protein Musashi homolog 1b; wu:fb40b12; zgc:103751; zMsi1