RAB11A Monoclonal Antibody (4H9) | Invitrogen MA5-49197 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

RAB11A Monoclonal Antibody (4H9)

catalog :

MA5-49197

quantity :

100 ug

price :

US 404.00

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4H9

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

RAB11A Monoclonal Antibody (4H9)

Catalog # :

MA5-49197

Quantity :

100 ug

Price :

US 404.00

Clonality :

Monoclonal

Purity :

Antigen affinity chromatography

Host :

Mouse

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.25-0.5 ug/mL

Species :

Human, Mouse, Rat

Clone :

4H9

Isotype :

IgG2b

Storage :

-20 C

Description :

Rab11A is a member of the YPT-1 subfamily of Ras-related GTP-binding proteins. Rab11A mRNA has been detected in a variety of tissues including brain, testis, spleen, heart, and gastrointestinal mucosa. In the gastric fundus the Rab11A protein is expressed in parietal cell tubulovesicles membranes. Expression of the Rab11A protein appears to occur in discrete epithelial cell populations where it localizes to apical vesicular populations. Recent studies have shown Rab11A is essential for resecretion of alpha-synuclein out of neuronal cells via endosome recycling and is required for exocytosis of discoidal/fusiform vesicles of bladder umbrella cells. Rab11A is also implicated in biogenesis of Birbeck granules and endosomal activation of the PI3K/AKT signaling pathway via G beta gamma trafficking.

Immunogen :

EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPK
VQ).
A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.25-0.5 ug/mL

Aliases :

24KG; RAB 11A, member oncogene family; RAB11; rab-11; rab11 GTP-binding protein; Rab11a; RAB11a, member RAS oncogene family; ras-related protein Rab-11A; tubulovesicle-associated protein; YL8