SHP2 Monoclonal Antibody (2E6) | Invitrogen MA5-49146 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

SHP2 Monoclonal Antibody (2E6)

catalog :

MA5-49146

quantity :

100 ug

price :

US 404.00

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2.00E+06

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

SHP2 Monoclonal Antibody (2E6)

Catalog # :

MA5-49146

Quantity :

100 ug

Price :

US 404.00

Clonality :

Monoclonal

Purity :

Antigen affinity chromatography

Host :

Mouse

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Clone :

2.00E+06

Isotype :

IgG2b

Storage :

-20 C

Description :

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

2700084A17Rik; AW536184; bptp3; CFC; cSH-PTP2; encodes catalytic domain; HCP; HGNC:9644; JMML; METCDS; MGC14433; Noonan syndrome 1; ns1; null; OTTHUMP00000166108; phosphotyrosyl-protein phosphatase; protein tyrosine phosphatase non-receptor type 11; protein tyrosine phosphatase SH-PTP2; protein tyrosine phosphatase, non-receptor type 11; protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1); protein tyrosine phosphatase, non-receptor type 11 S homeolog; protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; protein-tyrosine phosphatase SYP; PTP1C; PTP1D; PTP-1D; ptp-2; PTP2C; PTP-2C; Ptpn11; ptpn11.S; ptpn11-a; ptpn11-b; SAP-2; SH2 domain-containing protein tyrosine phosphatase-2; Shp2; shp-2; SHPTP2; SH-PTP2; SH-PTP2 protein tyrosine phosphatase non-receptor type 11; SH-PTP2 protein tyrosine phosphatase, non-receptor type 11; SH-PTP3; Syp; Tyrosine-protein phosphatase non-receptor type 11; XELAEV_18010676mg