This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
MBP Monoclonal Antibody (7D2)
catalog :
MA5-47369
quantity :
500 uL
price :
US 1648.00
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human, mouse, rat, bovine, pigs , domestic horse
application :
western blot, immunohistochemistry, immunocytochemistry
product information
Product Type :
Antibody
Product Name :
MBP Monoclonal Antibody (7D2)
Catalog # :
MA5-47369
Quantity :
500 uL
Price :
US 1648.00
Clonality :
Monoclonal
Purity :
Protein A/G
Host :
Mouse
Reactivity :
Bovine, Equine, Human, Mouse, Porcine, Rat
Applications :
Immunocytochemistry: 1:2,000-1:5,000, Immunohistochemistry: 1:10,000, Western Blot: 1:5,000-1:10,000
Species :
Bovine, Equine, Human, Mouse, Porcine, Rat
Clone :
7D2
Isotype :
IgG1
Storage :
Store at 4 C short term. For long term storage, store at -20 C, avoiding freeze/thaw cycles.
Description :
The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.
Immunogen :
amino acids 145-184 of the human 21.5kDa sequence.
AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKL
G,
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide
AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKL
G,
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide
Format :
Liquid
Applications w/Dilutions :
Immunocytochemistry: 1:2,000-1:5,000, Immunohistochemistry: 1:10,000, Western Blot: 1:5,000-1:10,000
Aliases :
20 kDa microtubule-stabilizing protein; C76307; golli mbp; Golli-mbp; Golli-MBP; myelin basic protein; Golli-Mbp; myelin basic protein; myelin basic protein S; Hmbpr; MBP; MBP S; Mbps; MGC99675; microtubule-stabilizing protein; mld; MOBP; Myelin A1 protein; myelin basic protein; myelin basic protein Golli-mbp; myelin basic protein S; myelin deficient; myelin membrane encephalitogenic protein; Myelin P1 protein; myelin-associated oligodendrocyte basic protein; R75289; shi; shiverer; Unknown (protein for IMAGE:7984318); unnamed protein product
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments