HMG4 Monoclonal Antibody (8H9) | Invitrogen MA5-36241 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

HMG4 Monoclonal Antibody (8H9)

catalog :

MA5-36241

quantity :

100 ug

price :

US 474.00

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

8H9

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry

product information

Product Type :

Antibody

Product Name :

HMG4 Monoclonal Antibody (8H9)

Catalog # :

MA5-36241

Quantity :

100 ug

Price :

US 474.00

Clonality :

Monoclonal

Purity :

Affinity chromatography

Host :

Mouse

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Clone :

8H9

Isotype :

IgG2b

Storage :

-20 C

Description :

HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of the HMG box subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly and transcription.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

high mobility group box 3; high mobility group protein 1; high mobility group protein 2a; High mobility group protein 4; high mobility group protein B1; high mobility group protein B3; high mobilty group protein 2A; high-mobility group (nonhistone chromosomal) protein 4; high-mobility group protein 4; HMG-1; HMG2a; HMG-2a; HMG4; HMG-4; HMGB1; Hmgb3; HMGB3 transcript variant 1/2; MGC90319; RGD1564407; Unknown (protein for MGC:133786)