RbAp48 Monoclonal Antibody (9F3) | Invitrogen MA5-33003 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

RbAp48 Monoclonal Antibody (9F3)

catalog :

MA5-33003

quantity :

100 ug

price :

US 474.00

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

9F3

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

RbAp48 Monoclonal Antibody (9F3)

Catalog # :

MA5-33003

Quantity :

100 ug

Price :

US 474.00

Clonality :

Monoclonal

Purity :

Affinity chromatography

Host :

Mouse

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Clone :

9F3

Isotype :

IgG1

Storage :

-20 C

Description :

RbAp48-11G10 recognizes full length RbAp48, a 48 kDa nuclear protein first isolated by its ability to interact with the carboxyl-terminus of the retinoblastoma protein (Rb). It is a member of the WD (Trp-Asp) repeat family of proteins. RbAp48 is one of the three subunits of CAF-1, can bind to histone H4 and is a subunit of human histone deacetylase HD1.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

CAF-1 p48 subunit; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; chromatin assembly factor 1 subunit C; Chromatin assembly factor I p48 subunit; chromatin assembly factor/CAF-1 p48 subunit; histone-binding protein RBBP4; lin-53; mRbAp48; MSI1 protein homolog; nucleosome-remodeling factor subunit RBAP48; NURF55; RB binding protein 4, chromatin remodeling factor; RBAP48; RBBP4; RBBP-4; retinoblastoma binding protein 4; retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48