SMN1/SMN2 Monoclonal Antibody (2B10) | Invitrogen MA5-27878 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

SMN1/SMN2 Monoclonal Antibody (2B10)

catalog :

MA5-27878

quantity :

100 ug

price :

US 414.00

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2B10

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

SMN1/SMN2 Monoclonal Antibody (2B10)

Catalog # :

MA5-27878

Quantity :

100 ug

Price :

US 414.00

Clonality :

Monoclonal

Purity :

Antigen affinity chromatography

Host :

Mouse

Reactivity :

Human, Mouse, Rat

Applications :

Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Immunohistochemistry: 1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Clone :

2B10

Isotype :

IgG1

Storage :

-20 C

Description :

The SMN1 gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein - survival motor neuron protein. The SMN complex plays a catalyst role in the assemble of small nuclear ribonucleoproteins, the building blocks of the spliceosome. Mutations in the SMN1 gene are known to cause spinal muscular atrophy 1/2.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH).

Format :

Lyophilized

Applications w/Dilutions :

Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Immunohistochemistry: 1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

AI849087; BCD541; component of gems 1; Gemin1; Gemin-1; SMA; SMA@; SMA1; SMA2; SMA3; SMA4; Smn; SMN1; SMN2; SMNC; SMNT; survival motor neuron 1; survival motor neuron 1 protein; survival motor neuron protein; survival of motor neuron 1, telomeric; survival of motor neuron protein; T-BCD541; TDRD16A; tudor domain containing 16A