CCT3 Monoclonal Antibody (12H4) | Invitrogen MA5-27872 product information

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

CCT3 Monoclonal Antibody (12H4)

catalog :

MA5-27872

quantity :

100 µg

price :

US 385.00

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

12H4

reactivity :

human, mouse

application :

western blot, immunocytochemistry

more info or order :

Invitrogen product webpage

citations: 3

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; loading ...; fig s7c western blot; human; loading ...; fig s1c, s3f	Showalter A, Martini A, Nierenberg D, Hosang K, Fahmi N, Gopalan P, et al. Investigating Chaperonin-Containing TCP-1 subunit 2 as an essential component of the chaperonin complex for tumorigenesis. Sci Rep. 2020;10:798 pubmed publisher
	Cox A, Nierenberg D, Camargo O, Lee E, Khaled A, Mazar J, et al. Chaperonin containing TCP-1 (CCT/TRiC) is a novel therapeutic and diagnostic target for neuroblastoma. Front Oncol. 2022;12:975088 pubmed publisher
	Ghozlan H, Showalter A, Lee E, Zhu X, Khaled A. Chaperonin-Containing TCP1 Complex (CCT) Promotes Breast Cancer Growth Through Correlations With Key Cell Cycle Regulators. Front Oncol. 2021;11:663877 pubmed publisher

product information

Product Type :

Antibody

Product Name :

CCT3 Monoclonal Antibody (12H4)

Catalog # :

MA5-27872

Quantity :

100 µg

Price :

US 385.00

Clonality :

Monoclonal

Purity :

Antigen affinity chromatography

Host :

Mouse

Reactivity :

Human

Applications :

Immunocytochemistry: 5 µg/mL, Western Blot: 0.1-0.5 µg/mL

Species :

Human

Clone :

12H4

Isotype :

IgG1

Storage :

-20°C

Description :

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Immunogen :

EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSR
Q).
A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa

Format :

Lyophilized

Applications w/Dilutions :

Immunocytochemistry: 5 µg/mL, Western Blot: 0.1-0.5 µg/mL

Aliases :

AL024092; CCT3; CCTG; CCT-gamma; chaperonin containing TCP1 subunit 3; chaperonin containing Tcp1, subunit 3 (gamma); chaperonin subunit 3 (gamma); hTRiC5; Matricin; mTRiC-P5; OTTHUMP00000025735; PIG48; T-complex protein 1 subunit gamma; T-complex protein 1, gamma subunit; TCP1 (t-complex-1) ring complex, polypeptide 5; TCP-1-gamma; Tcp1-rs3; TRIC5; TriC-P5

more info or order :

Invitrogen product webpage