This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Ataxin 1 Monoclonal Antibody (N76/8)
catalog :
MA5-27666
quantity :
100 ug
price :
US 514.00
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
N76/8

The same clone is also sold as:
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
product information
Product Type :
Antibody
Product Name :
Ataxin 1 Monoclonal Antibody (N76/8)
Catalog # :
MA5-27666
Quantity :
100 ug
Price :
US 514.00
Clonality :
Monoclonal
Purity :
Protein G
Host :
Mouse
Reactivity :
Human, Mouse, Rat
Applications :
Immunocytochemistry: 1:100, Immunohistochemistry (PFA fixed): 1:100, Immunoprecipitation: Assay-Dependent, Western Blot: 1:1,000
Species :
Human, Mouse, Rat
Clone :
N76/8
Isotype :
IgG2b
Storage :
-20 C
Description :
The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the 'pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 41-81 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). At least two transcript variants encoding the same protein have been found for this gene.
Immunogen :
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Format :
Liquid
Applications w/Dilutions :
Immunocytochemistry: 1:100, Immunohistochemistry (PFA fixed): 1:100, Immunoprecipitation: Assay-Dependent, Western Blot: 1:1,000
Aliases :
2900016G23Rik; alternative ataxin1; ataxin 1; Ataxin1; ataxin-1; Atx1; Atx-1; Atx-1-PB; Atxn1; C85907; CG4547; CG4547-PB; D6S504E; dAtx-1; Dmel CG4547; Dmel_CG4547; ENSMUSG00000074917; Gm10786; OTTHUMP00000016065; SCA1; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA