This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
SUR2A Monoclonal Antibody (N319A/14)
catalog :
MA5-27637
quantity :
100 ug
price :
US 514.00
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry
citations: 1
product information
Product Type :
Antibody
Product Name :
SUR2A Monoclonal Antibody (N319A/14)
Catalog # :
MA5-27637
Quantity :
100 ug
Price :
US 514.00
Clonality :
Monoclonal
Purity :
Protein G
Host :
Mouse
Reactivity :
Human, Mouse, Rat
Applications :
Immunocytochemistry: 1:100, Immunohistochemistry (PFA fixed): 1:100, Western Blot: 1:1,000
Species :
Human, Mouse, Rat
Clone :
N319A/14
Isotype :
IgG2a
Storage :
-20 C
Description :
Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell.
Immunogen :
cytoplasmic C-terminus) of mouse SUR2A
(SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLV
MTNK,
Fusion protein amino acids 1505-1546
(SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLV
MTNK,
Fusion protein amino acids 1505-1546
Format :
Liquid
Applications w/Dilutions :
Immunocytochemistry: 1:100, Immunohistochemistry (PFA fixed): 1:100, Western Blot: 1:1,000
Aliases :
ABC37; ABCC9; AI414027; AI449286; ATFB12; ATP binding cassette subfamily C member 9; ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, subfamily C (CFTR/MRP), member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; CANTU; cardiac ventricle sulfonyl urea receptor; CMD1O; FLJ36852; membrane receptor protein; si:dkey-183c2.3; Sulfonylurea receptor 2; sulfonylurea receptor subunit 2; sulfonylurea-binding protein 2; sulphonylurea receptor 2; sulphonylurea receptor 2A; sulphonylurea receptor 2B; SUR2; SUR2A; SUR2B
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
