This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
MRP1 Monoclonal Antibody (IU5C1)
catalog :
MA5-16079
quantity :
100 uL
price :
US 474.00
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
IU5C1

The same clone is also sold as:
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
MRP1 Monoclonal Antibody (IU5C1)
Catalog # :
MA5-16079
Quantity :
100 uL
Price :
US 474.00
Clonality :
Monoclonal
Purity :
Protein G
Host :
Mouse
Reactivity :
Human, Mouse
Applications :
Immunocytochemistry: 1:10-1:2,000, Immunohistochemistry (Paraffin): 1:200, Western Blot: 1:250-1:500
Species :
Human, Mouse
Clone :
IU5C1
Isotype :
IgG1
Storage :
-20 C, Avoid Freeze/Thaw Cycles
Description :
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutathione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms.
Immunogen :
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein.
Format :
Liquid
Applications w/Dilutions :
Immunocytochemistry: 1:10-1:2,000, Immunohistochemistry (Paraffin): 1:200, Western Blot: 1:250-1:500
Aliases :
ABC29; ABCC; Abcc1; Abcc1a; Abcc1b; ATP binding cassette subfamily C member 1; ATP-binding cassette sub-family C ( CFTR/MRP) member 1a; ATP-binding cassette sub-family C member 1; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex13 ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex25 ATP-binding cassette, subfamily C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1a; ATP-binding cassette, sub-family C (CFTR/MRP), member 1b; Avcc1a; DKFZp686N04233; DKFZp781G125; Glutathione-S-conjugate-translocating ATPase ABCC1; GS-X; leuk; leukotriene C(4) transporter; LTC4 transporter; Mdrap; MRP; Mrp1; multidrug resistance protein 1; multidrug resistance-associated protein 1; multiple drug resistance-associated protein
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA