Integrin α3 Antibody, cytoplasmic domain, clone 29A3 | EMD Millipore MAB2290 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

EMD Millipore

other brands :

Oncogene Research Products, Calbiochem, Novagen, Merck, Upstate Biotechnology, Chemicon, LINCO, Novabiochem, Guava

product type :

antibody

product name :

Integrin α3 Antibody, cytoplasmic domain, clone 29A3

catalog :

MAB2290

quantity :

100 µg

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

29A3

The same clone is also sold as:

Abcam: ab8985
OriGene: BM6022P
Santa Cruz Biotechnology: sc-59966
LifeSpan Biosciences: LS-C24751, LS-C146754

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry

citations: 8

Published Application/Species/Sample/Dilution	Reference
western blot; human	Costa P, Scales T, Ivaska J, Parsons M. Integrin-specific control of focal adhesion kinase and RhoA regulates membrane protrusion and invasion. PLoS ONE. 2013;8:e74659 pubmed publisher
	Scales T, Jayo A, Obara B, Holt M, Hotchin N, Berditchevski F, et al. ?3?1 integrins regulate CD151 complex assembly and membrane dynamics in carcinoma cells within 3D environments. Oncogene. 2013;32:3965-79 pubmed publisher
	Qu H, Wen T, Pesch M, Aumailley M. Partial loss of epithelial phenotype in kindlin-1-deficient keratinocytes. Am J Pathol. 2012;180:1581-92 pubmed publisher
	Aina O, Maeda Y, Harrison M, Zwingenberger A, Walker N, Lam K, et al. Canine malignant melanoma alpha-3 integrin binding peptides. Vet Immunol Immunopathol. 2011;143:11-9 pubmed publisher
	Ihara Y, Inai Y, Ikezaki M. Alteration of integrin-dependent adhesion and signaling in EMT-like MDCK cells established through overexpression of calreticulin. J Cell Biochem. 2011;112:2518-28 pubmed publisher
	Cheng C, Gilson T, Dallaire F, Ketner G, Branton P, Blanchette P. The E4orf6/E1B55K E3 ubiquitin ligase complexes of human adenoviruses exhibit heterogeneity in composition and substrate specificity. J Virol. 2011;85:765-75 pubmed publisher
	Dallaire F, Blanchette P, Branton P. A proteomic approach to identify candidate substrates of human adenovirus E4orf6-E1B55K and other viral cullin-based E3 ubiquitin ligases. J Virol. 2009;83:12172-84 pubmed publisher
	Dallaire F, Blanchette P, Groitl P, Dobner T, Branton P. Identification of integrin alpha3 as a new substrate of the adenovirus E4orf6/E1B 55-kilodalton E3 ubiquitin ligase complex. J Virol. 2009;83:5329-38 pubmed publisher

product information

Catalog Number :

MAB2290

Subcategory :

Cell Structure

Product Name :

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

Product Type :

Antibodies

Clonality :

Monoclonal Antibody

Gene ID :

P26006

Host Name :

Mouse

Antigen :

Integrin α3

Clone :

29A3

Conjugate :

Purified

Isotype :

IgG1

Product Description :

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

Cross Reactivity :

Human

Background :

Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha 3 and alpha 6, two cytoplasmic variants, A and B, have been identified.

ALT Names :

CD49c

Immunogen :

Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY

Specificity :

Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart. SPECIES REACTIVITIES: Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.

Package Size :

100 µg

Uses :

Western Blotting;Immunocytochemistry;Immunohistochemistry

Storage :

Store at 2-8°C, or in small aliquots at -20°C.