EGFR Antibody | EMD Millipore 06-847 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

EMD Millipore

other brands :

Oncogene Research Products, Calbiochem, Novagen, Merck, Upstate Biotechnology, Chemicon, LINCO, Novabiochem, Guava

product type :

antibody

product name :

EGFR Antibody

catalog :

06-847

quantity :

200 µg

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunocytochemistry, immunoprecipitation

citations: 12

Published Application/Species/Sample/Dilution	Reference
western blot; human; loading ...; fig s4e, s4f	Jeppesen D, Fenix A, Franklin J, Higginbotham J, Zhang Q, Zimmerman L, et al. Reassessment of Exosome Composition. Cell. 2019;177:428-445.e18 pubmed publisher
western blot; human; 1:1000; loading ...; fig 2f	Sapmaz A, Berlin I, Bos E, Wijdeven R, Janssen H, Konietzny R, et al. USP32 regulates late endosomal transport and recycling through deubiquitylation of Rab7. Nat Commun. 2019;10:1454 pubmed publisher
western blot; human; loading ...; fig 5e	Xue Z, Vis D, Bruna A, Sustic T, van Wageningen S, Batra A, et al. MAP3K1 and MAP2K4 mutations are associated with sensitivity to MEK inhibitors in multiple cancer models. Cell Res. 2018;28:719-729 pubmed publisher
western blot; human; 1:1000; fig s1b	Mai W, Gosa L, Daniëls V, Ta L, Tsang J, Higgins B, et al. Cytoplasmic p53 couples oncogene-driven glucose metabolism to apoptosis and is a therapeutic target in glioblastoma. Nat Med. 2017;23:1342-1351 pubmed publisher
western blot; mouse; fig 5a	Huang S, Mao J, Ding K, Zhou Y, Zeng X, Yang W, et al. Polysaccharides from Ganoderma lucidum Promote Cognitive Function and Neural Progenitor Proliferation in Mouse Model of Alzheimer's Disease. Stem Cell Reports. 2017;8:84-94 pubmed publisher
immunoprecipitation; mouse; fig 2 western blot; mouse; fig 1 western blot; human; fig s3	Wang J, Farris A, Xu K, Wang P, Zhang X, Duong D, et al. GPRC5A suppresses protein synthesis at the endoplasmic reticulum to prevent radiation-induced lung tumorigenesis. Nat Commun. 2016;7:11795 pubmed publisher
immunocytochemistry; human; 1:500; fig 3 western blot; human; 1:1000; fig 3	Gschweitl M, Ulbricht A, Barnes C, Enchev R, Stoffel Studer I, Meyer Schaller N, et al. A SPOPL/Cullin-3 ubiquitin ligase complex regulates endocytic trafficking by targeting EPS15 at endosomes. elife. 2016;5:e13841 pubmed publisher
	Sato T, Yoo S, Kong R, Sinha A, Chandramani Shivalingappa P, Patel A, et al. Epigenomic Profiling Discovers Trans-lineage SOX2 Partnerships Driving Tumor Heterogeneity in Lung Squamous Cell Carcinoma. Cancer Res. 2019;79:6084-6100 pubmed publisher
	Cho J, You Y, Yeom Y, Lee D, Kim B, Won M, et al. RNF25 promotes gefitinib resistance in EGFR-mutant NSCLC cells by inducing NF-?B-mediated ERK reactivation. Cell Death Dis. 2018;9:587 pubmed publisher
	Lu Y, Zhao X, Liu Q, Li C, Graves Deal R, Cao Z, et al. lncRNA MIR100HG-derived miR-100 and miR-125b mediate cetuximab resistance via Wnt/β-catenin signaling. Nat Med. 2017;23:1331-1341 pubmed publisher
	Wei Y, Kim T, Peng D, Duan D, Gibbons D, Yamauchi M, et al. Fibroblast-specific inhibition of TGF-?1 signaling attenuates lung and tumor fibrosis. J Clin Invest. 2017;127:3675-3688 pubmed publisher
	Lee H, Khan S, Khaliqdina S, Altintas M, Grahammer F, Zhao J, et al. Absence of miR-146a in Podocytes Increases Risk of Diabetic Glomerulopathy via Up-regulation of ErbB4 and Notch-1. J Biol Chem. 2017;292:732-747 pubmed publisher

product information

Catalog Number :

06-847

Subcategory :

Cell Signaling

Product Name :

Anti-EGFR Antibody

Product Type :

Antibodies

Clonality :

Polyclonal Antibody

Gene ID :

P00533

Host Name :

Rabbit

Antigen :

EGFR

Conjugate :

Purified

Isotype :

IgG

Product Description :

Anti-EGFR Antibody

Cross Reactivity :

Human;Mouse;Rat;Hamster

Background :

The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.

ALT Names :

Receptor tyrosine-protein kinase ErbB-1;avian erythroblastic leukemia viral (v-erb-b) oncogene homolog;cell growth inhibiting protein 40;cell proliferation-inducing protein 61;epidermal growth factor receptor;epidermal growth factor receptor (avian erythroblastic leukemia viral (v-erb-b) oncogene homolog);epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)

Immunogen :

Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.

Specificity :

Recognizes the EGFR, Mr 180 kDa.

Package Size :

200 µg

Uses :

Immunoprecipitation;Western Blotting

Storage :

Stable for 1 year at 2-8°C from date of receipt. Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution.