STAT3 Antibody | EMD Millipore 06-596 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

EMD Millipore

other brands :

Oncogene Research Products, Calbiochem, Novagen, Merck, Upstate Biotechnology, Chemicon, LINCO, Novabiochem, Guava

product type :

antibody

product name :

STAT3 Antibody

catalog :

06-596

quantity :

200 µg

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, immunoprecipitation, EMSA, chromatin immunoprecipitation

citations: 5

Published Application/Species/Sample/Dilution	Reference
immunoprecipitation; mouse; loading ...; fig 2d	Chuang H, Tsai C, Hsueh C, Tan T. GLK-IKKβ signaling induces dimerization and translocation of the AhR-RORγt complex in IL-17A induction and autoimmune disease. Sci Adv. 2018;4:eaat5401 pubmed publisher
western blot; mouse; fig 3d	Wang Y, Kuang Z, Yu X, Ruhn K, Kubo M, Hooper L. The intestinal microbiota regulates body composition through NFIL3 and the circadian clock. Science. 2017;357:912-916 pubmed publisher
chromatin immunoprecipitation; human; fig 3	M L, P P, T K, M P, E S, J P, et al. Essential role of HDAC6 in the regulation of PD-L1 inÂ melanoma. Mol Oncol. 2016;10:735-750 pubmed publisher
western blot; mouse; loading ...; fig s3b	Trierweiler C, Hockenjos B, Zatloukal K, Thimme R, Blum H, Wagner E, et al. The transcription factor c-JUN/AP-1 promotes HBV-related liver tumorigenesis in mice. Cell Death Differ. 2016;23:576-82 pubmed publisher
	Sato Y, Katoh Y, Matsumoto M, Sato M, Ebina M, Itoh Nakadai A, et al. Regulatory signatures of liver regeneration distilled by integrative analysis of mRNA, histone methylation, and proteomics. J Biol Chem. 2017;292:8019-8037 pubmed publisher

product information

Catalog Number :

06-596

Subcategory :

Epigenetics & Nuclear Function

Product Name :

Anti-STAT3 Antibody

Product Type :

Antibodies

Clonality :

Polyclonal Antibody

Gene ID :

P40763

Host Name :

Rabbit

Antigen :

STAT3

Conjugate :

Purified

Isotype :

IgG

Product Description :

Anti-STAT3 Antibody

Cross Reactivity :

Human;Mouse;Rat

Background :

STAT proteins (Signal Transduction and Activators of Transcription) are latent cytoplasmic transcription factors that have the dual function of signal transduction and activation of transcription. STATs are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus. The N-terminal region is highly homologous among the STAT proteins and surrounds a completely conserved arginine residue. STATs are a part of the JAK-STAT signaling pathway – a major pathway of the immune system. All cytokines transduce critical signals through this pathway. STAT3 has been shown to be activated by IFN alpha but not IFN beta. The transcription factors associated with STAT3 are cJun and cyclic AMP responsive enhancer binding protein (CREB). Deletion of the STAT3 gene in knock out mice was lethal at the early embryonic stage.

ALT Names :

Acute-phase response factor;DNA-binding protein APRF;signal transducer and activator of transcription;signal transducer and activator of transcription;(acute-phase response factor)

Immunogen :

Bacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.

Specificity :

Recognizes STAT3, Mr 92 kDa. Additional unknown bands may be detected.

Package Size :

200 µg

Uses :

Electrophoretic Mobility Shift Assay;Immunocytochemistry;Immunoprecipitation;Western Blotting

Storage :

Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.