Gab1 Antibody, CT | EMD Millipore 06-579 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

EMD Millipore

other brands :

Oncogene Research Products, Calbiochem, Novagen, Merck, Upstate Biotechnology, Chemicon, LINCO, Novabiochem, Guava

product type :

antibody

product name :

Gab1 Antibody, CT

catalog :

06-579

quantity :

200 µg

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 3

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; loading ...; fig 2c	Sutherland L, Ruhe M, Gattegno Ho D, Mann K, Greaves J, Koscielniak M, et al. LIF-dependent survival of embryonic stem cells is regulated by a novel palmitoylated Gab1 signalling protein. J Cell Sci. 2018;131: pubmed publisher
immunocytochemistry; human; 1:1000; loading ...; fig 4d	Saldivar J, Hamperl S, Bocek M, Chung M, Bass T, Cisneros Soberanis F, et al. An intrinsic S/G2 checkpoint enforced by ATR. Science. 2018;361:806-810 pubmed publisher
immunoprecipitation; human; fig 2s2 western blot; human; fig 2s2	Jadwin J, Oh D, Curran T, Ogiue Ikeda M, Jia L, White F, et al. Time-resolved multimodal analysis of Src Homology 2 (SH2) domain binding in signaling by receptor tyrosine kinases. elife. 2016;5:e11835 pubmed publisher

product information

Catalog Number :

06-579

Subcategory :

Cell Signaling

Product Name :

Anti-Gab1 Antibody, CT

Product Type :

Antibodies

Clonality :

Polyclonal Antibody

Gene ID :

Q13480

Host Name :

Rabbit

Antigen :

Gab1

Conjugate :

Purified

Isotype :

IgG

Product Description :

Anti-Gab1 Antibody, CT

Cross Reactivity :

Human;Mouse;Rat

Background :

Gab1 is a 115 kDa multiple docking protein that plays an essential role in cellular growth, transformation and apoptosis. Gab1 can be phosphorylated by multiple receptor tyrosine kinase (RTKs), including: insulin receptor (IR), platelet derived growth factor receptor beta] (PDGFR-β]), hepatocyte growth factor/scatter factor receptor (HGFR/SFR or c Met), and epidermal growth factor receptor (EGF), as well as in response to cell cell adhesion. Gab1 is tyrosine phosphorylated on at least 16 sites, some of which serve as binding sites for phosphoatidylinositol 3 kinase (PI3K), Grb2, PLC gamma 1, Nck, and SHP2. Phosphorylation of Gab1 on tyrosines 627 and 659 is critical for its binding to SHP2, and for activation of the ERK/MAPK pathway in response to EGF.

ALT Names :

GRB2-associated binder;GRB2-associated binding protein;Growth factor receptor bound protein 2-associated protein

Immunogen :

31 residue peptide sequence corresponding to C-terminal residues 664-694 of Gab1, (CQKTLALKSTREAWTDGRQSTESETPAKSVK).

Specificity :

Specific for Gab1. No other known protein shares more than 10 amino acids with the immunizing sequence.

Package Size :

200 µg

Uses :

Immunocytochemistry;Immunohistochemistry (Paraffin);Immunoprecipitation;Western Blotting

Storage :

Stable for 1 year at -20ºC from date of receipt. Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.