MAP Kinase 1/2 (Erk1/2) Antibody, CT | EMD Millipore 06-182 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

EMD Millipore

other brands :

Oncogene Research Products, Calbiochem, Novagen, Merck, Upstate Biotechnology, Chemicon, LINCO, Novabiochem, Guava

product type :

antibody

product name :

MAP Kinase 1/2 (Erk1/2) Antibody, CT

catalog :

06-182

quantity :

100 μg

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunocytochemistry, immunoprecipitation

citations: 9

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; loading ...; fig s3a	He P, Yang J, Yang V, Bialkowska A. Krüppel-like Factor 5, Increased in Pancreatic Ductal Adenocarcinoma, Promotes Proliferation, Acinar-to-Ductal Metaplasia, Pancreatic Intraepithelial Neoplasia, and Tumor Growth in Mice. Gastroenterology. 2018;154:1494-1508.e13 pubmed publisher
western blot; human; loading ...; fig 7	Reuther C, Heinzle V, Nölting S, Herterich S, Hahner S, Halilovic E, et al. The HDM2 (MDM2) Inhibitor NVP-CGM097 Inhibits Tumor Cell Proliferation and Shows Additive Effects with 5-Fluorouracil on the p53-p21-Rb-E2F1 Cascade in the p53wild type Neuroendocrine Tumor Cell Line GOT1. Neuroendocrinology. 2018;106:1-19 pubmed publisher
western blot; human; fig 6	Stepanenko A, Andreieva S, Korets K, Mykytenko D, Baklaushev V, Huleyuk N, et al. Temozolomide promotes genomic and phenotypic changes in glioblastoma cells. Cancer Cell Int. 2016;16:36 pubmed publisher
western blot; mouse; fig 7	Frank R, Komiyama N, Ryan T, Zhu F, O Dell T, Grant S. NMDA receptors are selectively partitioned into complexes and supercomplexes during synapse maturation. Nat Commun. 2016;7:11264 pubmed publisher
western blot; human; loading ...; fig 4b	Reuther C, Heinzle V, Spampatti M, Vlotides G, de Toni E, Spöttl G, et al. Cabozantinib and Tivantinib, but Not INC280, Induce Antiproliferative and Antimigratory Effects in Human Neuroendocrine Tumor Cells in vitro: Evidence for 'Off-Target' Effects Not Mediated by c-Met Inhibition. Neuroendocrinology. 2016;103:383-401 pubmed publisher
western blot; human; 1:5000	Lodillinsky C, Infante E, Guichard A, ChalignÃ© R, Fuhrmann L, Cyrta J, et al. p63/MT1-MMP axis is required for in situ to invasive transition in basal-like breast cancer. Oncogene. 2016;35:344-57 pubmed publisher
	Galan Davila A, Ryu J, Dong K, Xiao Y, Dai Z, Zhang D, et al. Alternative splicing variant of the scaffold protein APPL1 suppresses hepatic adiponectin signaling and function. J Biol Chem. 2018;293:6064-6074 pubmed publisher
	Arcuri L, Novello S, Frassineti M, Mercatelli D, Pisano C, Morella I, et al. Antiparkinsonian and antidyskinetic profiles of two novel potent and selective nociceptin/orphanin FQ receptor agonists. Br J Pharmacol. 2017;: pubmed publisher
	Grünberg J, Hoffmann J, Hedjazifar S, Nerstedt A, Jenndahl L, Elvin J, et al. Overexpressing the novel autocrine/endocrine adipokine WISP2 induces hyperplasia of the heart, white and brown adipose tissues and prevents insulin resistance. Sci Rep. 2017;7:43515 pubmed publisher

product information

Catalog Number :

06-182

Subcategory :

Cell Signaling

Product Name :

Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT

Product Type :

Antibodies

Clonality :

Polyclonal Antibody

Gene ID :

P28482

Host Name :

Rabbit

Antigen :

MAP Kinase 1/2 (Erk1/2)

Conjugate :

Affinity Purified

Isotype :

IgG

Product Description :

Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT

Cross Reactivity :

Avian;Human;Mouse;Rat;Sheep;Xenopus;Echinoderms

Background :

The extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called p44 and p42 MAP kinases, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44 kDa ERK1 and the 42 kDa ERK2 are highly homologous and both function in the same protein kinase cascade, the two proteins are often referred to collectively as ERK1/2 or p44/p42 MAP kinase. The ERK1/2 signaling cascade has been shown to be a critical regulator of cell differentiation, cell physiology and neuronal function. Aberrant control of ERK1/2 activity has been implicated in a variety of pathological conditions, including cancer and autoimmune diseases, and efficient study methods are in demand.

Immunogen :

38 residue synthetic peptide (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of the rat 44kDa MAP Kinase 2/Erk2

Specificity :

Recognizes MAPK1/Erk1 and MAPK2/Erk2.

Package Size :

100 μg

Uses :

Immunocytochemistry;Immunoprecipitation;Western Blotting

Storage :

Maintain for 1 year at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.