MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal | EMD Millipore 05-957 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

EMD Millipore

other brands :

Oncogene Research Products, Calbiochem, Novagen, Merck, Upstate Biotechnology, Chemicon, LINCO, Novabiochem, Guava

product type :

antibody

product name :

MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal

catalog :

05-957

quantity :

100 µL

clonality :

monoclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

mouse, rat

application :

western blot, immunoprecipitation

citations: 2

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; 1:1000; fig 6	Jarosz M, Robbez Masson L, Chioni A, Cross B, Rosewell I, Grose R. Fibroblast growth factor 22 is not essential for skin development and repair but plays a role in tumorigenesis. PLoS ONE. 2012;7:e39436 pubmed publisher
	Chen J, Heldman M, Herrmann M, Kedei N, Woo W, Blumberg P, et al. Absolute quantitation of endogenous proteins with precision and accuracy using a capillary Western system. Anal Biochem. 2013;442:97-103 pubmed publisher

product information

Catalog Number :

05-957

Subcategory :

Cell Signaling

Product Name :

Anti-MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal

Product Type :

Antibodies

Clonality :

Monoclonal Antibody

Gene ID :

P28482

Host Name :

Rabbit

Antigen :

MAP Kinase 1/Erk 1

Conjugate :

Purified

Isotype :

IgG

Product Description :

Anti-MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal

Cross Reactivity :

Mouse;Rat

Immunogen :

synthetic peptide corresponding to rat Erk1, amino acids 346-380 (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP)

Specificity :

MAP Kinase 1/Erk1

Package Size :

100 µL

Uses :

Immunoprecipitation;Western Blotting

Storage :

2 years at -20°C from date of shipment