product summary
company name :
Developmental Studies Hybridoma Bank
product type :
antibody
product name :
AP-2 alpha
catalog :
3B5
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B5
reactivity :
tree shrew, human, mouse, rat, chicken, zebrafish
application :
western blot, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section, immunocytochemistry knockout validation
citations: 70
Published Application/Species/Sample/DilutionReference
  • immunocytochemistry knockout validation; human; loading ...; fig 5a
Tchieu J, Zimmer B, Fattahi F, Amin S, Zeltner N, Chen S, et al. A Modular Platform for Differentiation of Human PSCs into All Major Ectodermal Lineages. Cell Stem Cell. 2017;21:399-410.e7 pubmed publisher
  • immunohistochemistry - frozen section; chicken; 1:200; loading ...; fig s6a
Chen X, Emerson M. Notch signaling represses cone photoreceptor formation through the regulation of retinal progenitor cell states. Sci Rep. 2021;11:14525 pubmed publisher
  • immunohistochemistry - frozen section; mouse; loading ...; fig 3c
Deng X, Iwagawa T, Fukushima M, Suzuki Y, Watanabe S. Setd1a Plays Pivotal Roles for the Survival and Proliferation of Retinal Progenitors via Histone Modifications of Uhrf1. Invest Ophthalmol Vis Sci. 2021;62:1 pubmed publisher
  • immunohistochemistry; mouse; 1:20; loading ...; fig 8q
Ofek S, Wiszniak S, Kagan S, Tondl M, Schwarz Q, Kalcheim C. Notch signaling is a critical initiator of roof plate formation as revealed by the use of RNA profiling of the dorsal neural tube. BMC Biol. 2021;19:84 pubmed publisher
  • immunohistochemistry; chicken; 1:100; loading ...; fig 6d
Yamagata M, Yan W, Sanes J. A cell atlas of the chick retina based on single-cell transcriptomics. elife. 2021;10: pubmed publisher
  • immunohistochemistry; mouse; 1:100; loading ...; fig 2b, 2c
Sanchez J, Miyake R, Cheng A, Liu T, Iseki S, Kume T. Conditional inactivation of Foxc1 and Foxc2 in neural crest cells leads to cardiac abnormalities. Genesis. 2020;58:e23364 pubmed publisher
  • immunohistochemistry - frozen section; chicken; 1:200; loading ...; fig s8c
Schick E, McCaffery S, Keblish E, Thakurdin C, Emerson M. Lineage tracing analysis of cone photoreceptor associated cis-regulatory elements in the developing chicken retina. Sci Rep. 2019;9:9358 pubmed publisher
  • immunohistochemistry - frozen section; mouse; 1:20; loading ...; fig 6h
Lukacs M, ROBERTS T, Chatuverdi P, Stottmann R. Glycosylphosphatidylinositol biosynthesis and remodeling are required for neural tube closure, heart development, and cranial neural crest cell survival. elife. 2019;8: pubmed publisher
  • immunohistochemistry - frozen section; chicken; 1:1000; loading ...; fig 3a
Martin J, Muccioli M, Herman K, Finnell R, Plageman T. Folic acid modifies the shape of epithelial cells during morphogenesis via a Folr1 and MLCK dependent mechanism. Biol Open. 2019;8: pubmed publisher
  • immunohistochemistry; tree shrew; 1:500; loading ...; fig 6i
Johnson E, Westbrook T, Shayesteh R, Chen E, Schumacher J, Fitzpatrick D, et al. Distribution and diversity of intrinsically photosensitive retinal ganglion cells in tree shrew. J Comp Neurol. 2019;527:328-344 pubmed publisher
  • western blot; human; loading ...; fig 2a
  • immunohistochemistry - paraffin section; mouse; 1:400; loading ...; fig 3
Jain S, Glubrecht D, Germain D, Moser M, Godbout R. AP-2ε Expression in Developing Retina: Contributing to the Molecular Diversity of Amacrine Cells. Sci Rep. 2018;8:3386 pubmed publisher
  • immunohistochemistry; mouse; 1:50; loading ...; fig 1b
Zhao F, Franco H, Rodriguez K, Brown P, Tsai M, Tsai S, et al. Elimination of the male reproductive tract in the female embryo is promoted by COUP-TFII in mice. Science. 2017;357:717-720 pubmed publisher
  • immunocytochemistry; human; 1:100; loading ...; fig 1c
  • immunohistochemistry; human; 1:100; fig 6a
Naylor R, McGhee C, Cowan C, Davidson A, Holm T, Sherwin T. Derivation of Corneal Keratocyte-Like Cells from Human Induced Pluripotent Stem Cells. PLoS ONE. 2016;11:e0165464 pubmed publisher
  • immunohistochemistry - frozen section; mouse; 1:50; fig 3
Simmons A, Bloomsburg S, Billingslea S, Merrill M, Li S, Thomas M, et al. Pou4f2 knock-in Cre mouse: A multifaceted genetic tool for vision researchers. Mol Vis. 2016;22:705-17 pubmed
  • immunohistochemistry; mouse; 1:250; fig 3
Li X, Gaillard F, Monckton E, Glubrecht D, Persad A, Moser M, et al. Loss of AP-2delta reduces retinal ganglion cell numbers and axonal projections to the superior colliculus. Mol Brain. 2016;9:62 pubmed publisher
  • immunohistochemistry; mouse; fig s2
Krishnaswamy A, Yamagata M, Duan X, Hong Y, Sanes J. Sidekick 2 directs formation of a retinal circuit that detects differential motion. Nature. 2015;524:466-470 pubmed publisher
  • immunohistochemistry - frozen section; rat
Kermorvant Duchemin E, Pinel A, Lavalette S, Lenne D, Raoul W, Calippe B, et al. Neonatal hyperglycemia inhibits angiogenesis and induces inflammation and neuronal degeneration in the retina. PLoS ONE. 2013;8:e79545 pubmed publisher
  • immunohistochemistry; chicken
Boije H, Ring H, Shirazi Fard S, Grundberg I, Nilsson M, Hallböök F. Alternative splicing of the chromodomain protein Morf4l1 pre-mRNA has implications on cell differentiation in the developing chicken retina. J Mol Neurosci. 2013;51:615-28 pubmed publisher
  • immunohistochemistry - paraffin section; mouse; 1:50
Willaredt M, Gorgas K, Gardner H, Tucker K. Multiple essential roles for primary cilia in heart development. Cilia. 2012;1:23 pubmed publisher
  • immunocytochemistry; chicken; 1:50
Yan R, Liang L, Ma W, Li X, Xie W, Wang S. Neurogenin1 effectively reprograms cultured chick retinal pigment epithelial cells to differentiate toward photoreceptors. J Comp Neurol. 2010;518:526-46 pubmed publisher
  • immunohistochemistry - frozen section; chicken; 1:100
Fischer A, Stanke J, Aloisio G, Hoy H, Stell W. Heterogeneity of horizontal cells in the chicken retina. J Comp Neurol. 2007;500:1154-71 pubmed
Thier M, Hommerding O, Panten J, Pinna R, García González D, Berger T, et al. Identification of Embryonic Neural Plate Border Stem Cells and Their Generation by Direct Reprogramming from Adult Human Blood Cells. Cell Stem Cell. 2019;24:166-182.e13 pubmed publisher
Pei S, Liu L, Zhong Z, Wang H, Lin S, Shang J. Risk of prenatal depression and stress treatment: alteration on serotonin system of offspring through exposure to Fluoxetine. Sci Rep. 2016;6:33822 pubmed publisher
Leung A, Murdoch B, Salem A, Prasad M, Gomez G, García Castro M. WNT/β-catenin signaling mediates human neural crest induction via a pre-neural border intermediate. Development. 2016;143:398-410 pubmed publisher
Michailovici I, Harrington H, Azogui H, Yahalom Ronen Y, Plotnikov A, Ching S, et al. Nuclear to cytoplasmic shuttling of ERK promotes differentiation of muscle stem/progenitor cells. Development. 2014;141:2611-20 pubmed publisher
Vincent S, Mayeuf Louchart A, Watanabe Y, Brzezinski J, Miyagawa Tomita S, Kelly R, et al. Prdm1 functions in the mesoderm of the second heart field, where it interacts genetically with Tbx1, during outflow tract morphogenesis in the mouse embryo. Hum Mol Genet. 2014;23:5087-101 pubmed publisher
Kerr C, Zaveri M, Robinson M, Williams T, West Mays J. AP-2? is required after lens vesicle formation to maintain lens integrity. Dev Dyn. 2014;243:1298-309 pubmed publisher
Edlund R, Ohyama T, Kantarci H, Riley B, Groves A. Foxi transcription factors promote pharyngeal arch development by regulating formation of FGF signaling centers. Dev Biol. 2014;390:1-13 pubmed publisher
Kurosaka H, Iulianella A, Williams T, Trainor P. Disrupting hedgehog and WNT signaling interactions promotes cleft lip pathogenesis. J Clin Invest. 2014;124:1660-71 pubmed publisher
Li X, Persad A, Monckton E, Godbout R. Transcription factor AP-2delta regulates the expression of polysialyltransferase ST8SIA2 in chick retina. FEBS Lett. 2014;588:770-5 pubmed publisher
Forni P, Bharti K, Flannery E, Shimogori T, Wray S. The indirect role of fibroblast growth factor-8 in defining neurogenic niches of the olfactory/GnRH systems. J Neurosci. 2013;33:19620-34 pubmed publisher
Nakamoto C, Kuan S, Findlay A, Durward E, Ouyang Z, Zakrzewska E, et al. Nel positively regulates the genesis of retinal ganglion cells by promoting their differentiation and survival during development. Mol Biol Cell. 2014;25:234-44 pubmed publisher
Lee R, Nagai H, Nakaya Y, Sheng G, Trainor P, Weston J, et al. Cell delamination in the mesencephalic neural fold and its implication for the origin of ectomesenchyme. Development. 2013;140:4890-902 pubmed publisher
Sugiyama Y, Shelley E, Wen L, Stump R, Shimono A, Lovicu F, et al. Sfrp1 and Sfrp2 are not involved in Wnt/?-catenin signal silencing during lens induction but are required for maintenance of Wnt/?-catenin signaling in lens epithelial cells. Dev Biol. 2013;384:181-93 pubmed publisher
Leung A, Kent Morest D, Li J. Differential BMP signaling controls formation and differentiation of multipotent preplacodal ectoderm progenitors from human embryonic stem cells. Dev Biol. 2013;379:208-20 pubmed publisher
Tran T, Bedecarrats G, Choh V. Inner retinal cell development is impaired in Smoky Joe chickens. Poult Sci. 2013;92:1322-30 pubmed publisher
Zhang T, Liu J, Zhang J, Thekkethottiyil E, Macatee T, Ismat F, et al. Jun is required in Isl1-expressing progenitor cells for cardiovascular development. PLoS ONE. 2013;8:e57032 pubmed publisher
Zarelli V, Dawid I. Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2. Proc Natl Acad Sci U S A. 2013;110:2870-5 pubmed publisher
Boije H, Shirazi Fard S, Ring H, Hallbook F. Forkheadbox N4 (FoxN4) triggers context-dependent differentiation in the developing chick retina and neural tube. Differentiation. 2013;85:11-9 pubmed publisher
Menendez L, Kulik M, Page A, Park S, Lauderdale J, Cunningham M, et al. Directed differentiation of human pluripotent cells to neural crest stem cells. Nat Protoc. 2013;8:203-12 pubmed publisher
Luan Z, Liu Y, Stuhlmiller T, Marquez J, GARCIA CASTRO M. SUMOylation of Pax7 is essential for neural crest and muscle development. Cell Mol Life Sci. 2013;70:1793-806 pubmed publisher
Lüningschrör P, Kaltschmidt B, Kaltschmidt C. Knockdown of IKK1/2 promotes differentiation of mouse embryonic stem cells into neuroectoderm at the expense of mesoderm. Stem Cell Rev. 2012;8:1098-108 pubmed publisher
Quina L, Kuramoto T, Luquetti D, Cox T, Serikawa T, Turner E. Deletion of a conserved regulatory element required for Hmx1 expression in craniofacial mesenchyme in the dumbo rat: a newly identified cause of congenital ear malformation. Dis Model Mech. 2012;5:812-22 pubmed publisher
Sham C, Chan A, Kwong J, Caprioli J, Nusinowitz S, Chen B, et al. Neuronal programmed cell death-1 ligand expression regulates retinal ganglion cell number in neonatal and adult mice. J Neuroophthalmol. 2012;32:227-37 pubmed
Prasov L, Glaser T. Dynamic expression of ganglion cell markers in retinal progenitors during the terminal cell cycle. Mol Cell Neurosci. 2012;50:160-8 pubmed publisher
Bassett E, Korol A, Deschamps P, Buettner R, Wallace V, Williams T, et al. Overlapping expression patterns and redundant roles for AP-2 transcription factors in the developing mammalian retina. Dev Dyn. 2012;241:814-29 pubmed publisher
Law H, Lin A, Kim Y, Quach B, Nano F, Guttman J. Francisella tularensis uses cholesterol and clathrin-based endocytic mechanisms to invade hepatocytes. Sci Rep. 2011;1:192 pubmed publisher
Romano R, Smalley K, Magraw C, Serna V, Kurita T, Raghavan S, et al. ΔNp63 knockout mice reveal its indispensable role as a master regulator of epithelial development and differentiation. Development. 2012;139:772-82 pubmed publisher
Katyal S, Glubrecht D, Li L, Gao Z, Godbout R. Disabled-1 alternative splicing in human fetal retina and neural tumors. PLoS ONE. 2011;6:e28579 pubmed publisher
Sakagami K, Chen B, Nusinowitz S, Wu H, Yang X. PTEN regulates retinal interneuron morphogenesis and synaptic layer formation. Mol Cell Neurosci. 2012;49:171-83 pubmed publisher
Mesbah K, Rana M, Francou A, van Duijvenboden K, Papaioannou V, Moorman A, et al. Identification of a Tbx1/Tbx2/Tbx3 genetic pathway governing pharyngeal and arterial pole morphogenesis. Hum Mol Genet. 2012;21:1217-29 pubmed publisher
Freyer L, Aggarwal V, Morrow B. Dual embryonic origin of the mammalian otic vesicle forming the inner ear. Development. 2011;138:5403-14 pubmed publisher
Laurent M, Maryvonne L, Le Dreau G, Gwenvaël L, Guillonneau X, Xavier G, et al. Temporal and spatial expression of CCN3 during retina development. Dev Neurobiol. 2012;72:1363-75 pubmed publisher
Emerson M, Cepko C. Identification of a retina-specific Otx2 enhancer element active in immature developing photoreceptors. Dev Biol. 2011;360:241-55 pubmed publisher
Leli vre E, Lek M, Boije H, Houille Vernes L, Brajeul V, Slembrouck A, et al. Ptf1a/Rbpj complex inhibits ganglion cell fate and drives the specification of all horizontal cell subtypes in the chick retina. Dev Biol. 2011;358:296-308 pubmed publisher
Martínez Morales P, Diez del Corral R, Olivera Martínez I, Quiroga A, Das R, Barbas J, et al. FGF and retinoic acid activity gradients control the timing of neural crest cell emigration in the trunk. J Cell Biol. 2011;194:489-503 pubmed publisher
Ma Z, Wang J, Song F, Loeb J. Critical period of axoglial signaling between neuregulin-1 and brain-derived neurotrophic factor required for early Schwann cell survival and differentiation. J Neurosci. 2011;31:9630-40 pubmed publisher
Schmidt M, Huber L, Majdazari A, Schutz G, Williams T, Rohrer H. The transcription factors AP-2? and AP-2? are required for survival of sympathetic progenitors and differentiated sympathetic neurons. Dev Biol. 2011;355:89-100 pubmed publisher
Okubo T, Kawamura A, Takahashi J, Yagi H, Morishima M, Matsuoka R, et al. Ripply3, a Tbx1 repressor, is required for development of the pharyngeal apparatus and its derivatives in mice. Development. 2011;138:339-48 pubmed publisher
Li X, Glubrecht D, Godbout R. AP2 transcription factor induces apoptosis in retinoblastoma cells. Genes Chromosomes Cancer. 2010;49:819-30 pubmed publisher
Gao Z, Monckton E, Glubrecht D, Logan C, Godbout R. The early isoform of disabled-1 functions independently of Reelin-mediated tyrosine phosphorylation in chick retina. Mol Cell Biol. 2010;30:4339-53 pubmed publisher
Marx M, Lebuhotel C, Laugier D, Chapelle A, Calothy G, Saule S. Down regulation of pRb in cultures of avian neuroretina cells promotes proliferation of reactive Müller-like cells and emergence of retinal stem/progenitors. Exp Eye Res. 2010;90:791-801 pubmed publisher
Ferran J, de Oliveira E, Merchan P, Sandoval J, Sánchez Arrones L, Martinez de la Torre M, et al. Genoarchitectonic profile of developing nuclear groups in the chicken pretectum. J Comp Neurol. 2009;517:405-51 pubmed publisher
Courtois Cox S, Genther Williams S, Reczek E, Johnson B, McGillicuddy L, Johannessen C, et al. A negative feedback signaling network underlies oncogene-induced senescence. Cancer Cell. 2006;10:459-72 pubmed
Sivak J, West Mays J, Yee A, Williams T, Fini M. Transcription Factors Pax6 and AP-2alpha Interact To Coordinate Corneal Epithelial Repair by Controlling Expression of Matrix Metalloproteinase Gelatinase B. Mol Cell Biol. 2004;24:245-57 pubmed
West Mays J, Zhang J, Nottoli T, Hagopian Donaldson S, Libby D, Strissel K, et al. AP-2alpha transcription factor is required for early morphogenesis of the lens vesicle. Dev Biol. 1999;206:46-62 pubmed
Turner B, Zhang J, Gumbs A, Maher M, Kaplan L, Carter D, et al. Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways. Cancer Res. 1998;58:5466-72 pubmed
Shen H, Wilke T, Ashique A, Narvey M, Zerucha T, Savino E, et al. Chicken transcription factor AP-2: cloning, expression and its role in outgrowth of facial prominences and limb buds. Dev Biol. 1997;188:248-66 pubmed
Bosher J, Totty N, Hsuan J, Williams T, Hurst H. A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma. Oncogene. 1996;13:1701-7 pubmed
Zhang J, Hagopian Donaldson S, Serbedzija G, Elsemore J, Plehn Dujowich D, McMahon A, et al. Neural tube, skeletal and body wall defects in mice lacking transcription factor AP-2. Nature. 1996;381:238-41 pubmed
product information
Internal ID :
1110
Name :
3B5
Depositor Name :
Williams, T.J.
Depositor Institution :
University of Colorado, Denver
Date Deposited :
3/24/99
Allow Hybridoma Distribution :
No
Cells Available (legacy) :
No
Antigen :
AP-2 alpha
Antigen Species :
Human
Host Species :
mouse
Isotype :
MIgG2b, kappa light chain
Isotype for catalog (legacy) :
IgG2b, kappa light chain
Positive Tested Species Reactivity :
Chicken,Human,Mouse,Zebrafish
Species Tested (legacy) :
human, mouse, chicken
Initial Publication Pubmed ID :
8895516
Depositor Notes (Special Instructions) :
AP-2 alpha specific. Does not react with AP-2 beta or AP-2 gamma. Immunoprecipitation also EMSA supershift analysis and ChIP-seq. Immunohistochemistry requires antigen retrieval, {see PMID: 9850080}.
Collections :
Cell markers,Human,Nucleus,Transcription factors
Search Keywords :
Williams, Trevor J., AP-2 alpha, Human, MIgG2b, kappa light chain, Human/Mouse/Chicken, TFAP2A, AP-2; BOFS; AP2TF; TFAP2; AP-2alpha, AB_2313948 AB_2313947 AB_528084 AB_2202275 AB_667767 AB_2199412 AB_1048155, monoclonal
Antigen Molecular Weight :
Predicted: 48kDa; Apparent: 50kDa
Gene :
TFAP2A
Alternate Gene Name(s) :
AP-2; BOFS; AP2TF; TFAP2; AP-2alpha
Uniprot ID :
P05549
Antibody Registry ID :
AB_528084
Immunogen :
AP-2 alpha delta N165
Immunogen Sequence :
KQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLN
Clonality :
Monoclonal
Myeloma Strain :
SP2/0
Epitope Mapped :
Yes
Epitope Location or Sequence :
AP-2 alpha sequence (amino acids 166-197)
Epitope Map PubMed ID :
8895516 9850080
Recommended Applications :
Chromatin Immunoprecipitation,FFPE,Gel Supershift,Immunofluorescence,Immunohistochemistry,Western Blot
Immunoblotting (legacy) :
yes
Immunohistochemistry Pubmed IDs :
8895516 8622766 9268573 9850080 9918694 22038708 20607706 21177346 17157787 24336726
Immunofluorescence Pubmed IDs :
23247248 24753151 24924195 24140542 24278148 22411557 22833419 20607706 22163036 22110056 21715628 22579728 21839069 21963459 22635166 22116936 21539825 22736458 22274697 24821700 24650709 23643939 23437302 23571342 23314287 23733253 24198279 23288320 29238991 30581079
Western Blot Pubmed IDs :
9850080 23382213 20607706 22355707 14673159
Chromatin Immunoprecipitation Pubmed IDs :
23382213
FFPE Pubmed IDs :
8622766 9850080 22411557 20607706 22116936 21177346
Gel Supershift Pubmed IDs :
24462686
Pubmed IDs :
24462686 24258025 20029995 20380833 20607706 22155156 20606009 21807879 24590292
DSHB Growth Medium :
Iscove's
References (legacy) :
Oncogene 13, 1701-1707.; Nature 381, 238-241.; Dev. Biol. 188, 248-266.; Cancer Res. 58, 5466-5472.; Dev. Biol. 206, 46-62.
company information
Developmental Studies Hybridoma Bank
University of Iowa
http://dshb.biology.uiowa.edu
headquarters: US