This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Creative BioMart
product type :
protein
product name :
Recombinant Human GCG Protein, His-tagged
catalog :
GCG-207H
product information
Cat :
GCG-207H
Product Name :
Recombinant Human GCG Protein, His-tagged
Brand :
Creative Biomart
gene symbal :
GCG
gene name :
GCG glucagon [ Homo sapiens ]
Synonyms :
GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide;
Product Overview :
GLP-1 (7-37) (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) K34R mutant peptide with His tag expressed in Escherichia coli.
Description :
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq
Source :
E. coli
Form :
Lyophilized
Purity :
>= 90% by RP-HPLC
Storage :
Store at -20 centigrade. After reconstitution with ddH2O, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
UniProt ID :
P01275
company information
Creative BioMart
NY, USA
contact@creative-biomart.com
http://www.creativebiomart.net
1-516-855-7709
headquarters: USA
Creative BioMart provides quality recombinant proteins, diagnostic antibodies and antigens, diagnostic enzymes and pharmaceutical enzymes to the research community of biology, clinical research, molecular diagnostics and biopharmaceutical drug development.

We are offering more than 3,000 recombinant proteins, peptides and antibodies. All the products are rigorously tested to meet the most demanding research needs. At the same time, lowest prices in the industry are always guaranteed.

Also, in order to leverage our core competencies and resources, Creative BioMart has formed a large number of corporate partnerships and academic collaborations for product development and distribution. We welcome potential partners and distributors to explore business relationships with Creative BioMart.