This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Creative BioMart
product type :
antibody
product name :
Anti-TNFSF10 monoclonal antibody, clone 3F6 [PE]
catalog :
DCABH-7664
quantity :
50 μg
clonality :
monoclonal
host :
mouse
conjugate :
PE
clone name :
3F6
reactivity :
human
application :
flow cytometry
product information
Cat :
DCABH-7664
Product Name :
Anti-TNFSF10 monoclonal antibody, clone 3F6 [PE]
Brand :
Creative Diagnostics
Abbr :
Anti-TNFSF10 MAb, PE-Conjugated
Host animal :
Mouse
Clone :
3F6
Official Symbol :
TNFSF10
Clonality :
Monoclonal
Application :
FC
Target :
TNFSF10
Species Reactivity :
Human
Conjugate :
PE
Antibody Type :
Primary Antibodies
Immunogen :
KALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQE EIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQ GGIFELKENDRIFVSVTNEHLIDMDHEASFFG
TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRS
NTLSSPNSKNE
Recombinant fragment corresponding to Human TRAIL aa 95-281.Sequence:
TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRS
NTLSSPNSKNE
Recombinant fragment corresponding to Human TRAIL aa 95-281.Sequence:
Alternative Names :
TNFSF10; tumor necrosis factor (ligand) superfamily, member 10; tumor necrosis factor ligand superfamily member 10; Apo 2L; CD253; TL2; TRAIL; Apo-2 ligand; TNF-related apoptosis inducing ligand TRAIL; tumor necrosis factor (ligand) family, member 10; che
UniProt ID :
P50591
Antibody Isotype :
IgG1
Size :
50 μg
Storage :
Store at +4°C. Store In the Dark.
company information

Creative BioMart
Creative BioMart provides quality recombinant proteins, diagnostic antibodies and antigens, diagnostic enzymes and pharmaceutical enzymes to the research community of biology, clinical research, molecular diagnostics and biopharmaceutical drug development.
We are offering more than 3,000 recombinant proteins, peptides and antibodies. All the products are rigorously tested to meet the most demanding research needs. At the same time, lowest prices in the industry are always guaranteed.
Also, in order to leverage our core competencies and resources, Creative BioMart has formed a large number of corporate partnerships and academic collaborations for product development and distribution. We welcome potential partners and distributors to explore business relationships with Creative BioMart.
questions and comments
