This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Creative BioMart
product type :
antibody
product name :
Anti-GRIN1 monoclonal antibody, clone T419-59 [HRP]
catalog :
DCABH-7659
quantity :
100 μg
clonality :
monoclonal
host :
mouse
conjugate :
HRP
clone name :
T419-59
reactivity :
rat
application :
western blot, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
Cat :
DCABH-7659
Product Name :
Anti-GRIN1 monoclonal antibody, clone T419-59 [HRP]
Brand :
Creative Diagnostics
Abbr :
Anti-GRIN1 MAb, HRP-Conjugated
Host animal :
Mouse
Clone :
T419-59
Official Symbol :
GRIN1
Clonality :
Monoclonal
Application :
IHC-Fr, IHC-P, WB, ICC/IF
Target :
GRIN1
Species Reactivity :
Rat
Conjugate :
HRP
Antibody Type :
Primary Antibodies
Immunogen :
VSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTV PPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKR
FREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCE
DLISSQVYAIL
Recombinant fragment corresponding to Rat NMDAR1 aa 42-361 (N terminal). N terminal extracellular domain.Sequence:
FREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCE
DLISSQVYAIL
Recombinant fragment corresponding to Rat NMDAR1 aa 42-361 (N terminal). N terminal extracellular domain.Sequence:
Alternative Names :
GRIN1; glutamate receptor, ionotropic, N-methyl D-aspartate 1; glutamate [NMDA] receptor subunit zeta-1; NMD-R1; neurotransmitter receptor; NMDA R1 receptor C1 cassette; N-methyl-D-aspartate glutamate receptor; N-methyl-D-aspartate receptor subunit NR1; N
UniProt ID :
P35439
Antibody Isotype :
IgG1
Size :
100 μg
Storage :
Store at +4°C.
company information

Creative BioMart
Creative BioMart provides quality recombinant proteins, diagnostic antibodies and antigens, diagnostic enzymes and pharmaceutical enzymes to the research community of biology, clinical research, molecular diagnostics and biopharmaceutical drug development.
We are offering more than 3,000 recombinant proteins, peptides and antibodies. All the products are rigorously tested to meet the most demanding research needs. At the same time, lowest prices in the industry are always guaranteed.
Also, in order to leverage our core competencies and resources, Creative BioMart has formed a large number of corporate partnerships and academic collaborations for product development and distribution. We welcome potential partners and distributors to explore business relationships with Creative BioMart.
questions and comments
