This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Creative BioMart
product type :
antibody
product name :
Anti-GRM5 monoclonal antibody, clone T86-44 [FITC]
catalog :
DCABH-7655
quantity :
100 μg
clonality :
monoclonal
host :
mouse
conjugate :
FITC
clone name :
T86-44
reactivity :
rat
application :
western blot, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
Cat :
DCABH-7655
Product Name :
Anti-GRM5 monoclonal antibody, clone T86-44 [FITC]
Brand :
Creative Diagnostics
Abbr :
Anti-GRM5 MAb, FITC-Conjugated
Host animal :
Mouse
Clone :
T86-44
Official Symbol :
GRM5
Clonality :
Monoclonal
Application :
IHC-P, IHC-Fr, WB
Target :
GRM5
Species Reactivity :
Rat
Conjugate :
FITC
Antibody Type :
Primary Antibodies
Immunogen :
TLRYKDRRLAQHKSEIECFTPKGSMGNGGRATMSSSNGKSVTWAQNEKST RGQHLWQRLSVHINKKENPNQTAVIKPFPKSTENRGPGAAAG
ILAKPERNVRSAFTTSTVVRMHVGDGKSSSAASRSSSLV
NLWKRRGSSGE
Recombinant fragment corresponding to Rat Metabotropic Glutamate Receptor 5 aa 824-1203 (C terminal).Sequence:
ILAKPERNVRSAFTTSTVVRMHVGDGKSSSAASRSSSLV
NLWKRRGSSGE
Recombinant fragment corresponding to Rat Metabotropic Glutamate Receptor 5 aa 824-1203 (C terminal).Sequence:
Alternative Names :
GRM5; glutamate receptor, metabotropic 5; metabotropic glutamate receptor 5; metabotropic glutamate receptor 5b; metabotropic glutamate receptor (mGluR5); mGluR5; mGlur5;
UniProt ID :
P31424
Antibody Isotype :
IgG1
Size :
100 μg
Storage :
Store at +4°C. Store In the Dark.
company information

Creative BioMart
Creative BioMart provides quality recombinant proteins, diagnostic antibodies and antigens, diagnostic enzymes and pharmaceutical enzymes to the research community of biology, clinical research, molecular diagnostics and biopharmaceutical drug development.
We are offering more than 3,000 recombinant proteins, peptides and antibodies. All the products are rigorously tested to meet the most demanding research needs. At the same time, lowest prices in the industry are always guaranteed.
Also, in order to leverage our core competencies and resources, Creative BioMart has formed a large number of corporate partnerships and academic collaborations for product development and distribution. We welcome potential partners and distributors to explore business relationships with Creative BioMart.
questions and comments
