This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-GTPase HRAS Antibody
catalog :
RP1099
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section
product information
SKU :
RP1099
Product Name :
Anti-GTPase HRAS Antibody
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Predicted Reactivity :
Bovine, Horse, Monkey, Rabbit
Application(s) :
IHC-P, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Mouse, Rat, Human. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Mouse, By Heat.
Application Notes :
Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-GTPase HRAS Antibody catalog # RP1099. Tested in IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
HRAS
Uniprot ID :
P01112
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
GTPase HRas
Synonyms :
GTPase HRas; H-Ras-1; Ha-Ras; Transforming protein p21; c-H-ras; p21ras; GTPase HRas, N-terminally processed; HRAS; HRAS1;
Protein Name :
GTPase Hras
Molecular Weight :
21298 MW
Protein Function :
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Subcellular Localization :
Cell membrane. Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Golgi apparatus membrane; Lipid-anchor. The active GTP-bound form is localized most strongly to membranes than the inactive GDP-bound form (By similarity). Shuttles between the plasma membrane and the Golgi apparatus.
Tissue Specificity :
Widely expressed.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
Research Category :
Apoptosis, Associated Proteins, Cancer, Cancer Susceptibility, Cell Biology, Cell Cycle, Cell Differentiation, Epigenetics and Nuclear Signaling, G Protein Signaling, Intracellular, Nucleotide Messenger, Proto-Oncogenes, Ras Family, Second Messenger, Signal Transduction, Signaling Pathway, Small G Proteins, Transcription
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits