This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-NM23A/NME1 Antibody
catalog :
RP1090
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry
product information
SKU :
RP1090
Product Name :
Anti-NM23A/NME1 Antibody
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Predicted Reactivity :
Hamster
Application(s) :
Flow Cytometry, IHC, ICC, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Mouse, RatImmunohistochemistry (Frozen Section), 0.5-1µg/ml, Human.
Immunocytochemistry, 0.5-1µg/ml, Human.
Flow Cytometry, 1-3μg/1x10^6 cells, Human
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-NM23A/NME1 Antibody catalog # RP1090. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
NME1
Uniprot ID :
P15531
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Nucleoside diphosphate kinase A
Synonyms :
Nucleoside diphosphate kinase A; NDK A; NDP kinase A; 2.7.4.6; Granzyme A-activated DNase; GAAD; Metastasis inhibition factor nm23; NM23-H1; Tumor metastatic process-associated protein; NME1; NDPKA, NM23;
Protein Name :
Nucleoside diphosphate kinase A
Molecular Weight :
17149 MW
Protein Function :
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein- coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair.
Subcellular Localization :
Cytoplasm. Nucleus. Cell-cycle dependent nuclear localization which can be induced by interaction with Epstein-barr viral proteins or by degradation of the SET complex by GzmA.
Tissue Specificity :
Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation. Isoform 3 is ubiquitously expressed.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(F) and ICC.
Background :
NME1 (NME/NM23 nucleoside diphosphate kinase 1), also called non-metastatic cells 1, protein (NM23A) expressed in, NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.
Research Category :
Cancer Susceptibility, Epigenetics and Nuclear Signaling, Transcription, Tumor Suppressors
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments