Anti-Macrophage metalloelastase MMP12 Antibody | Boster RP1089 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Macrophage metalloelastase MMP12 Antibody

catalog :

RP1089

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

mouse

application :

western blot, ELISA

product information

SKU :

RP1089

Product Name :

Anti-Macrophage metalloelastase MMP12 Antibody

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Mouse

Application(s) :

ELISA, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Mouse ELISA, 0.1-0.5µg/ml, Mouse.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Macrophage metalloelastase MMP12 Antibody catalog # RP1089. Tested in ELISA, WB applications. This antibody reacts with Mouse.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

Mmp12

Uniprot ID :

P34960

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Macrophage metalloelastase

Synonyms :

Macrophage metalloelastase; MME; 3.4.24.65; Matrix metalloproteinase-12; MMP-12; Mmp12; Mme, Mmel;

Protein Name :

Macrophage metalloelastase

Molecular Weight :

54971 MW

Protein Function :

May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3 (By similarity).

Subcellular Localization :

Secreted, extracellular space, extracellular matrix.

Background :

Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.

Research Category :

Angiogenesis, Atherosclerosis, Cancer, Cardiovascular, Cytoskeleton / Ecm, Ecm Enzymes, Extracellular Matrix, Invasion/Microenvironment, Signal Transduction, Tumor Biomarkers