This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-P Glycoprotein/ABCB1 Antibody
catalog :
RP1034
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
immunohistochemistry
product information
SKU :
RP1034
Product Name :
Anti-P Glycoprotein/ABCB1 Antibody
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
IHC
Application Details :
Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Mouse, RatImmunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat.
Application Notes :
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-P Glycoprotein/ABCB1 Antibody catalog # RP1034. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
ABCB1
Uniprot ID :
P08183
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein (621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Multidrug resistance protein 1
Synonyms :
Multidrug resistance protein 1; 3.6.3.44; ATP-binding cassette sub-family B member 1; P-glycoprotein 1; CD243; ABCB1; MDR1, PGY1;
Protein Name :
Multidrug resistance protein 1
Molecular Weight :
141479 MW
Protein Function :
Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Subcellular Localization :
Cell membrane ; Multi-pass membrane protein.
Tissue Specificity :
Expressed in liver, kidney, small intestine and brain.
Recommended Detection Systems :
Boster recommends HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and IHC(F).
Sequence Similarities :
Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
Background :
P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.
Research Category :
Apoptosis, Cell Biology, Intracellular, P53 Pathway
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits