Anti-P Glycoprotein/ABCB1 Antibody | Boster RP1034 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-P Glycoprotein/ABCB1 Antibody

catalog :

RP1034

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

immunohistochemistry

product information

SKU :

RP1034

Product Name :

Anti-P Glycoprotein/ABCB1 Antibody

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

IHC

Application Details :

Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Mouse, RatImmunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-P Glycoprotein/ABCB1 Antibody catalog # RP1034. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

ABCB1

Uniprot ID :

P08183

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein (621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Multidrug resistance protein 1

Synonyms :

Multidrug resistance protein 1; 3.6.3.44; ATP-binding cassette sub-family B member 1; P-glycoprotein 1; CD243; ABCB1; MDR1, PGY1;

Protein Name :

Multidrug resistance protein 1

Molecular Weight :

141479 MW

Protein Function :

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Subcellular Localization :

Cell membrane ; Multi-pass membrane protein.

Tissue Specificity :

Expressed in liver, kidney, small intestine and brain.

Recommended Detection Systems :

Boster recommends HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and IHC(F).

Sequence Similarities :

Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.

Background :

P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.

Research Category :

Apoptosis, Cell Biology, Intracellular, P53 Pathway